BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000122-TA|BGIBMGA000122-PA|undefined (216 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 23 1.4 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 21 7.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.9 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 9.9 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/48 (31%), Positives = 23/48 (47%) Query: 58 KGNEKQLQETWKVLTVLKNNNQPIIRKRQLMRTHFGDYRAKMASEEKK 105 K NEK KVL L +N + ++ + G+YR+K E +K Sbjct: 72 KCNEKVKANVRKVLHHLIDNKPDMWKQLEAKYDPSGEYRSKYKDELEK 119 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 21.0 bits (42), Expect = 7.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 58 KGNEKQLQETWKVLTVLKNNNQ 79 K +EKQ + T KV+ L +N Q Sbjct: 72 KCSEKQKEMTKKVIHFLSHNKQ 93 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 17 QKPCKIDKHESEGVDPEESLRQFQLELCWCIQQLERTL 54 +KPC I+++ G+D Q + W + + TL Sbjct: 206 RKPCSINENLKMGLDIASITAQASSFVVWPLVENNPTL 243 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 17 QKPCKIDKHESEGVDPEESLRQFQLELCWCIQQLERTL 54 +KPC I+++ G+D Q + W + + TL Sbjct: 206 RKPCSINENLKMGLDIASITAQASSFVVWPLVENNPTL 243 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 61 EKQLQETWKVLTVLKN 76 +K +Q+ W T LKN Sbjct: 324 KKIMQKAWSFFTALKN 339 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.126 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,704 Number of Sequences: 317 Number of extensions: 1788 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 216 length of database: 114,650 effective HSP length: 54 effective length of query: 162 effective length of database: 97,532 effective search space: 15800184 effective search space used: 15800184 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -