BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000121-TA|BGIBMGA000121- PA|IPR007704|Mannosyltransferase, DXD (428 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 3.0 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 6.9 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.4 bits (53), Expect = 3.0 Identities = 10/37 (27%), Positives = 20/37 (54%) Query: 285 IVKILAQVSKCVLLFLLSLNYGCDPKTLPFAMFAQAV 321 +V++ ++ L L+S YGC K +P+ + + V Sbjct: 538 VVELPGTTNRYYLHGLVSWGYGCHQKQIPYTVLTKVV 574 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 24.2 bits (50), Expect = 6.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 249 FLFETYIYHLLRKDTRHNFSILFYYTY 275 F+ + YIY LL+K R + + Y + Sbjct: 407 FMLDPYIYVLLKKSRRSDLRTMIRYMF 433 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.331 0.145 0.448 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,366 Number of Sequences: 2123 Number of extensions: 17786 Number of successful extensions: 37 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 34 Number of HSP's gapped (non-prelim): 3 length of query: 428 length of database: 516,269 effective HSP length: 66 effective length of query: 362 effective length of database: 376,151 effective search space: 136166662 effective search space used: 136166662 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -