Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000121-TA|BGIBMGA000121-
PA|IPR007704|Mannosyltransferase, DXD
         (428 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    22   8.6  

>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 22.2 bits (45), Expect = 8.6
 Identities = 10/47 (21%), Positives = 22/47 (46%)

Query: 205 NRNTPIKEGLVSLLPNKNQMILAFSCVTSLLFITYAMYLRYGYEFLF 251
           N N P+K   + ++   N  +   S +  +  I+  +Y R   E+++
Sbjct: 328 NENRPLKRRNIEIVAKNNDTLQFISGIKIIKQISSNIYERQNNEYIW 374


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.331    0.145    0.448 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,703
Number of Sequences: 429
Number of extensions: 5027
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 428
length of database: 140,377
effective HSP length: 60
effective length of query: 368
effective length of database: 114,637
effective search space: 42186416
effective search space used: 42186416
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.9 bits)
S2: 45 (22.2 bits)