BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000120-TA|BGIBMGA000120-PA|IPR005377|Vacuolar protein sorting-associated protein 26 (431 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 8.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 8.7 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 8.7 Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Query: 327 DDNSARATPSNPDPENVMQRSVSPSMPEKQNGPLQMEREKPEAFIDKLAGAHINENDTND 386 +DN N + +N +++ + KQNG Q + ++ ++ N+ND N Sbjct: 476 NDNKQNGNRQNDNKQNGNRQNGNKQNDNKQNGNRQNDNKRNG---NRQNDNQNNQNDNNR 532 Query: 387 TSDEI 391 +++ Sbjct: 533 NDNQV 537 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 8.7 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 136 RRLTDITKEVDIAVHTLCSYPDVLNSIKM 164 R +D+ KE+D++ + L S PD L + + Sbjct: 428 RNCSDL-KELDLSGNELTSVPDALRDLAL 455 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.135 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,006 Number of Sequences: 429 Number of extensions: 6413 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 2 length of query: 431 length of database: 140,377 effective HSP length: 60 effective length of query: 371 effective length of database: 114,637 effective search space: 42530327 effective search space used: 42530327 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -