BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000119-TA|BGIBMGA000119-PA|IPR000860|Porphobilinogen deaminase (407 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 26 0.42 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 24 1.7 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 5.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 5.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 6.9 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 6.9 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 26.2 bits (55), Expect = 0.42 Identities = 10/25 (40%), Positives = 17/25 (68%) Query: 363 NMPIDVVIKCDNLGRDLANSLIDKG 387 N+ +D +IK D L ++ N L++KG Sbjct: 30 NVDLDEIIKSDRLLKNYVNCLLEKG 54 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 24.2 bits (50), Expect = 1.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Query: 345 LAPNVADRRCFCGLTTNVNMPIDVVIKCDNLGRDLANSL 383 LAP + R+ +C L + + +V C GR LA +L Sbjct: 82 LAPVLCKRQQYCQLMSKLLGNHQLVYNCHTFGRFLAPNL 120 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.6 bits (46), Expect = 5.2 Identities = 8/17 (47%), Positives = 15/17 (88%) Query: 300 KHKLSPTEEASSKKIKT 316 + +L+P+++ASSK+I T Sbjct: 106 EERLTPSKDASSKRIXT 122 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 136 LRRTAQLNGNYPQLKVVDVRGN 157 L T L GN P L+V+D+ N Sbjct: 261 LNATKDLFGNMPHLQVLDLSHN 282 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 188 GNRMSKVLPCSEMLYAV 204 GNR+++ CS LYAV Sbjct: 710 GNRLARPANCSPDLYAV 726 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 224 LAPFNHPETYCRVLAERSF 242 L FNH E+Y R+ +SF Sbjct: 25 LVNFNHRESYFRLSKAKSF 43 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.134 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,397 Number of Sequences: 317 Number of extensions: 3413 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 6 length of query: 407 length of database: 114,650 effective HSP length: 58 effective length of query: 349 effective length of database: 96,264 effective search space: 33596136 effective search space used: 33596136 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -