BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000118-TA|BGIBMGA000118-PA|IPR000719|Protein kinase, IPR011009|Protein kinase-like, IPR008271|Serine/threonine protein kinase, active site, IPR002290|Serine/threonine protein kinase (900 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 27 0.75 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 23 7.0 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 26.6 bits (56), Expect = 0.75 Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 329 FGNKNLIRTTKEFRETKKNNNARLKAGSNCNEADEIYQEAVL 370 F N +++ + E+ NNN + G++C + + +AVL Sbjct: 444 FSNVEVVQEEAKKEESDSNNNNNKEEGNSCQYCNIAFGDAVL 485 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 251 DDEDFKISYRSPNQSDEESDRKLTTVKNKLRKILSDRD 288 DD+D +S + DEE R T + +++ + +D Sbjct: 158 DDDDALVSDSDDREKDEEDKRDDTDMHGRIKSERNGKD 195 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,087 Number of Sequences: 317 Number of extensions: 9011 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 3 length of query: 900 length of database: 114,650 effective HSP length: 63 effective length of query: 837 effective length of database: 94,679 effective search space: 79246323 effective search space used: 79246323 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -