BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000114-TA|BGIBMGA000114-PA|undefined (339 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. 25 3.0 AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. 25 3.0 AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. 25 3.0 AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. 23 9.3 >AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 25.0 bits (52), Expect = 3.0 Identities = 12/46 (26%), Positives = 21/46 (45%) Query: 138 QSFEWSDRLKTQKDAIQSTYRPKREHLKPKPDVKLSDFLAARTSLL 183 Q +W+ + QK Y P+ H+ + +K S LA ++L Sbjct: 91 QKHQWNQTITEQKGNYHECYMPQVIHVSREDQLKDSSGLAVSRAVL 136 >AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 25.0 bits (52), Expect = 3.0 Identities = 12/46 (26%), Positives = 21/46 (45%) Query: 138 QSFEWSDRLKTQKDAIQSTYRPKREHLKPKPDVKLSDFLAARTSLL 183 Q +W+ + QK Y P+ H+ + +K S LA ++L Sbjct: 91 QKHQWNQTITEQKGNYHECYMPQVIHVSREDQLKDSSGLAVSRAVL 136 >AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 25.0 bits (52), Expect = 3.0 Identities = 12/46 (26%), Positives = 21/46 (45%) Query: 138 QSFEWSDRLKTQKDAIQSTYRPKREHLKPKPDVKLSDFLAARTSLL 183 Q +W+ + QK Y P+ H+ + +K S LA ++L Sbjct: 91 QKHQWNQTITEQKGNYHECYMPQVIHVSREDQLKDSSGLAVSRAVL 136 >AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.4 bits (48), Expect = 9.3 Identities = 11/46 (23%), Positives = 20/46 (43%) Query: 138 QSFEWSDRLKTQKDAIQSTYRPKREHLKPKPDVKLSDFLAARTSLL 183 Q +W+ + QK Y P+ H+ + +K S L ++L Sbjct: 91 QKHQWNQTITEQKGNYHECYMPQVIHVSREDQLKDSSGLTVSRAVL 136 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.130 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 258,329 Number of Sequences: 2123 Number of extensions: 7905 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 4 length of query: 339 length of database: 516,269 effective HSP length: 64 effective length of query: 275 effective length of database: 380,397 effective search space: 104609175 effective search space used: 104609175 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -