BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000113-TA|BGIBMGA000113-PA|undefined (127 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 25 0.26 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 25 0.35 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 5.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 5.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 5.6 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 25.0 bits (52), Expect = 0.26 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 15 KRTKTID-LMNQLFDEKYELEPDFGHDSLAEISTYLIPYDYVTEGRYSVD 63 K +K ++ MN + + KY ++ DFG D + + YDY + VD Sbjct: 26 KSSKNLEHSMNVIHEWKY-IDYDFGSDEKRQAAIQSGEYDYTKNYPFDVD 74 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 24.6 bits (51), Expect = 0.35 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 18 KTIDLMNQLFDEKYELEPDFGHDSLAEISTYLIPYDYVTEGRYSVDTSR 66 K + MN + + KY L+ DFG D + + YD+ + VD R Sbjct: 30 KLANSMNVIHEWKY-LDYDFGSDERRQAAMQSGEYDHTKNYPFDVDQWR 77 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 74 LRSPWSCASKKSRRTCRKACK 94 +R + C +KS+ C KA K Sbjct: 411 VRPKYDCTLEKSQDDCLKAIK 431 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 74 LRSPWSCASKKSRRTCRKACK 94 +R + C +KS+ C KA K Sbjct: 411 VRPKYDCTLEKSQDDCLKAIK 431 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 74 LRSPWSCASKKSRRTCRKACK 94 +R + C +KS+ C KA K Sbjct: 411 VRPKYDCTLEKSQDDCLKAIK 431 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.133 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,228 Number of Sequences: 429 Number of extensions: 1506 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 127 length of database: 140,377 effective HSP length: 51 effective length of query: 76 effective length of database: 118,498 effective search space: 9005848 effective search space used: 9005848 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.0 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -