BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000110-TA|BGIBMGA000110-PA|IPR009053|Prefoldin, IPR010978|tRNA-binding arm (757 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 25 2.5 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 25 2.5 U61152-1|AAB41307.1| 45|Tribolium castaneum TATH2 protein. 24 4.4 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 7.7 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 24.6 bits (51), Expect = 2.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 346 LDDLHHDLAAQYDTVARLQADLSQAHAE 373 L+D++ DLA + + AR A LS AE Sbjct: 412 LEDINPDLAEAFSSYARKNARLSFGRAE 439 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 24.6 bits (51), Expect = 2.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 346 LDDLHHDLAAQYDTVARLQADLSQAHAE 373 L+D++ DLA + + AR A LS AE Sbjct: 237 LEDINPDLAEAFSSYARKNARLSFGRAE 264 >U61152-1|AAB41307.1| 45|Tribolium castaneum TATH2 protein. Length = 45 Score = 23.8 bits (49), Expect = 4.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 396 KHETNRLNSEIQSLRQRLDRADADLVHSRRENLRLSE 432 + N LN LRQ + DAD S+ E L++++ Sbjct: 7 RRRMNGLNEAFDRLRQVIPSLDADHKLSKFETLQMAQ 43 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 23.0 bits (47), Expect = 7.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Query: 594 VDISVKLIPKSRRRDKKRTAQLDEVALDDKGVKNSVSMEVSEG 636 + I+ L S+ K LDE+ D+ +KN V+ + +G Sbjct: 12 IAIASSLAENSKYTTKYDNVDLDEIIKSDRLLKNYVNCLLEKG 54 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.308 0.127 0.337 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,990 Number of Sequences: 317 Number of extensions: 5743 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 4 length of query: 757 length of database: 114,650 effective HSP length: 62 effective length of query: 695 effective length of database: 94,996 effective search space: 66022220 effective search space used: 66022220 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -