BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000108-TA|BGIBMGA000108-PA|undefined (420 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 25 0.76 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 5.4 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 25.4 bits (53), Expect = 0.76 Identities = 12/24 (50%), Positives = 14/24 (58%) Query: 263 SSKETSPMKSNPKTSTPEGSPAKV 286 SS TSP + P +T GSPA V Sbjct: 24 SSGMTSPAAAPPPATTSSGSPASV 47 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 5.4 Identities = 9/35 (25%), Positives = 20/35 (57%) Query: 119 PKHEPTFDSLSPNVKRIISSATEASALKFQKITTN 153 PK+ PTF LS +++ ++ + + ++ + T N Sbjct: 735 PKNRPTFTELSKSLEGLLENVAQYLQIENVEQTLN 769 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.307 0.126 0.343 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,742 Number of Sequences: 317 Number of extensions: 3686 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 420 length of database: 114,650 effective HSP length: 59 effective length of query: 361 effective length of database: 95,947 effective search space: 34636867 effective search space used: 34636867 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -