BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000106-TA|BGIBMGA000106-PA|IPR004217|Zinc finger, Tim10/DDP-type (93 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 2.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 20 3.7 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 20 3.7 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 2.1 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 59 VAKYLDVHERIGKKLSNMSQGETEDLTKVNI 89 +AK++ H GKK S+ S ++E+ ++ +I Sbjct: 390 LAKHVKTHNGNGKKGSSDSCSDSEENSQSDI 420 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.2 bits (40), Expect = 3.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 42 YHEPELGKGESVCLDRCVAKY 62 +++PE G E+V + V KY Sbjct: 1432 HYKPEFGDWETVQIGPTVEKY 1452 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 20.2 bits (40), Expect = 3.7 Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 58 CVAKYLDVHERIGKKLSNMSQGETE 82 C+A + D+ ERI +++ +T+ Sbjct: 11 CIACHPDIQERIFEEIEETFSDDTK 35 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,033 Number of Sequences: 317 Number of extensions: 773 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 93 length of database: 114,650 effective HSP length: 48 effective length of query: 45 effective length of database: 99,434 effective search space: 4474530 effective search space used: 4474530 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.8 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -