BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000105-TA|BGIBMGA000105-PA|IPR009003|Peptidase, trypsin-like serine and cysteine (113 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0804 + 32118107-32118541 27 2.6 07_01_0488 - 3678329-3678577,3678769-3678810,3678891-3678944,367... 27 3.5 07_03_1772 + 29411874-29413218,29413355-29413421,29413749-294138... 26 6.1 03_06_0557 + 34704990-34705400,34706271-34706485,34707142-347073... 26 6.1 05_04_0084 - 17788077-17789240 26 8.0 02_05_1092 - 34049640-34049934,34050013-34050147,34050229-340503... 26 8.0 >01_06_0804 + 32118107-32118541 Length = 144 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 6/32 (18%) Query: 16 GFKVPCYHSCDLPEFIEKN------KRCENYH 41 G + PCYH D P+F K RCE ++ Sbjct: 86 GDRPPCYHKLDFPKFDRKGDPIHFLNRCEQFY 117 >07_01_0488 - 3678329-3678577,3678769-3678810,3678891-3678944, 3679149-3679212,3679316-3679410,3679477-3679584, 3679679-3679752,3680338-3680410,3680539-3680586, 3680694-3680877,3681262-3681440,3682167-3682259, 3682738-3682851,3683570-3683644,3683852-3684112, 3684821-3684934,3685473-3685529,3686668-3686863, 3686922-3686986,3687112-3687195,3688155-3688223, 3688545-3688844 Length = 865 Score = 27.1 bits (57), Expect = 3.5 Identities = 14/54 (25%), Positives = 21/54 (38%) Query: 34 NKRCENYHGVEGGAVFDKKKNQLIGVATWGAYYPKYELPVGYSVANSDNFYADY 87 N +C G A+F + + Q + V T G Y + S +FY Y Sbjct: 424 NSQCGLLPRAHGSALFTRGETQALAVVTLGDYQMAQRIDNLVDTEESKSFYLQY 477 >07_03_1772 + 29411874-29413218,29413355-29413421,29413749-29413896, 29415293-29415416,29416340-29416590,29416923-29418449, 29418786-29418896,29419576-29419734,29419827-29421734 Length = 1879 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 10 YFDKIKGFKVPCYHSCDLPEFIEKNKRCENYHGVEGGAVFDKKKN 54 YF K+ G +PC+H C L E + R N E +F + N Sbjct: 1204 YFGKVGG--IPCHHECILDEELGLACRLCNVVCTEAKDIFPEMFN 1246 >03_06_0557 + 34704990-34705400,34706271-34706485,34707142-34707367, 34707447-34707532,34708030-34708121,34708232-34708471, 34709455-34709750 Length = 521 Score = 26.2 bits (55), Expect = 6.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 64 AYYPKYELPVGYSVANSDNFYADYMCAKRIKMDND 98 A+YP Y +P G ++ + D + + C D+D Sbjct: 312 AWYPIYRIPTGPTLEDLDACFLTFHCLATPSKDSD 346 >05_04_0084 - 17788077-17789240 Length = 387 Score = 25.8 bits (54), Expect = 8.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 25 CDLPEFIEKNKRCENYHGVEGGAVFDKKKNQ 55 C PEF+ K KR + G +G V K+K + Sbjct: 186 CTRPEFLNKPKREKGKKGKKGKDVGKKRKRE 216 >02_05_1092 - 34049640-34049934,34050013-34050147,34050229-34050305, 34050541-34050624,34050699-34050849,34050944-34051060, 34051162-34051219,34051412-34051502,34051601-34051648, 34051724-34051792,34051881-34051904,34052125-34052233, 34052338-34052375,34052524-34052672,34052765-34052780 Length = 486 Score = 25.8 bits (54), Expect = 8.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Query: 19 VPCYHSCDLPEFIEKNKRCEN 39 VP Y SC P + NKRC N Sbjct: 184 VPSYTSCHEPPQDKTNKRCTN 204 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.141 0.466 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,717,108 Number of Sequences: 37544 Number of extensions: 144659 Number of successful extensions: 209 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 204 Number of HSP's gapped (non-prelim): 6 length of query: 113 length of database: 14,793,348 effective HSP length: 73 effective length of query: 40 effective length of database: 12,052,636 effective search space: 482105440 effective search space used: 482105440 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -