BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000105-TA|BGIBMGA000105-PA|IPR009003|Peptidase, trypsin-like serine and cysteine (113 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) 28 2.1 SB_21988| Best HMM Match : DNA_primase_S (HMM E-Value=0.0096) 26 6.3 >SB_54041| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-11) Length = 1461 Score = 27.9 bits (59), Expect = 2.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 2 DLCSNIMTYFDKIKGFKVPCYHSCD 26 D+C N+ DK+KG K CD Sbjct: 167 DVCGNVRGTLDKLKGIKSDLVRGCD 191 >SB_21988| Best HMM Match : DNA_primase_S (HMM E-Value=0.0096) Length = 153 Score = 26.2 bits (55), Expect = 6.3 Identities = 15/38 (39%), Positives = 20/38 (52%) Query: 22 YHSCDLPEFIEKNKRCENYHGVEGGAVFDKKKNQLIGV 59 Y S E +EK + N H ++ GAVF KK Q + V Sbjct: 80 YQSFASQEEMEKEIQKRNPHKIDIGAVFSHKKMQSMEV 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.324 0.141 0.466 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,419,941 Number of Sequences: 59808 Number of extensions: 174620 Number of successful extensions: 255 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 253 Number of HSP's gapped (non-prelim): 2 length of query: 113 length of database: 16,821,457 effective HSP length: 73 effective length of query: 40 effective length of database: 12,455,473 effective search space: 498218920 effective search space used: 498218920 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -