BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000105-TA|BGIBMGA000105-PA|IPR009003|Peptidase, trypsin-like serine and cysteine (113 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-1462|AAF50412.1| 2444|Drosophila melanogaster CG6915-PA... 26 10.0 >AE014296-1462|AAF50412.1| 2444|Drosophila melanogaster CG6915-PA protein. Length = 2444 Score = 26.2 bits (55), Expect = 10.0 Identities = 16/85 (18%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Query: 15 KGFKVPCYHSCDLPEFIEKNKRCENYHGVEGGAVFDKKKNQLIGVATW-GAYYPKYELPV 73 +G KVP S + E +++ + Y+ + G +F +G+ + A + L + Sbjct: 1131 EGSKVPLADSESIQETVDRGRTTVLYYSLAGDQLFTWLLEPHVGIVRFHAAKIDAHSLQL 1190 Query: 74 GYSVANSDNFYADYMCAKRIKMDND 98 S++ + D + +K++ D Sbjct: 1191 PLSLSEEEEEEEDLEMERELKLNRD 1215 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.324 0.141 0.466 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,466,681 Number of Sequences: 52641 Number of extensions: 263988 Number of successful extensions: 445 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 445 Number of HSP's gapped (non-prelim): 1 length of query: 113 length of database: 24,830,863 effective HSP length: 75 effective length of query: 38 effective length of database: 20,882,788 effective search space: 793545944 effective search space used: 793545944 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -