BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000103-TA|BGIBMGA000103-PA|IPR003034|DNA-binding SAP, IPR003877|SPla/RYanodine receptor SPRY, IPR001870|B302, (SPRY)-like (1282 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 31 0.067 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 27 0.62 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 26 1.9 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 30.7 bits (66), Expect = 0.067 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Query: 122 KDEQLAKEPNNRNESDEQ-----EDDKAMDTQESTGPDDAKKHTAETMEHDGDDTEAKKQ 176 K+ ++ EP N+ + D+ DD+ D ++ DD H E +G D + Sbjct: 144 KENKMTWEPKNKTDDDDDALVSDSDDREKDEEDKR--DDTDMHGRIKSERNGKDLDDDDM 201 Query: 177 KNEESKED 184 +++ K+D Sbjct: 202 NDDDRKDD 209 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 27.5 bits (58), Expect = 0.62 Identities = 12/25 (48%), Positives = 15/25 (60%) Query: 113 EESTESQPTKDEQLAKEPNNRNESD 137 E+ TES T+ Q K P + NESD Sbjct: 416 EQPTESSTTQKPQTTKTPESGNESD 440 Score = 24.2 bits (50), Expect = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 604 NGENKTEKKDDSKPEPMETDEP 625 N N K D+ PEP+ T EP Sbjct: 380 NAINAALKSDEIPPEPVPTPEP 401 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 25.8 bits (54), Expect = 1.9 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Query: 276 RKEAKSANSKEQGKGKNKDAQPPPEIRVPEPELDDNKVTL 315 RKE K+ K++ N P++ EPEL D++ TL Sbjct: 268 RKEKKAQKEKDK---PNSTTNGSPDVIKVEPELSDSEKTL 304 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.130 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,665 Number of Sequences: 317 Number of extensions: 7275 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 4 length of query: 1282 length of database: 114,650 effective HSP length: 65 effective length of query: 1217 effective length of database: 94,045 effective search space: 114452765 effective search space used: 114452765 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -