BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000102-TA|BGIBMGA000102-PA|undefined (777 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 31 0.023 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 31 0.023 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 31.5 bits (68), Expect = 0.023 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 686 NDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAK 733 N D ++ E ++KP S+ + VD +NN N Q G+ E+ K Sbjct: 429 NFDALIVNEMRSEKPESKKDKKGSQVDHKNNLGDSKNNQDGNNGEKKK 476 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 31.5 bits (68), Expect = 0.023 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 686 NDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAK 733 N D ++ E ++KP S+ + VD +NN N Q G+ E+ K Sbjct: 321 NFDALIVNEMRSEKPESKKDKKGSQVDHKNNLGDSKNNQDGNNGEKKK 368 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.128 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,505 Number of Sequences: 317 Number of extensions: 5304 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 777 length of database: 114,650 effective HSP length: 62 effective length of query: 715 effective length of database: 94,996 effective search space: 67922140 effective search space used: 67922140 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -