BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000102-TA|BGIBMGA000102-PA|undefined (777 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61690.1 68416.m06913 expressed protein 36 0.077 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 36 0.14 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 34 0.31 At3g62170.1 68416.m06985 pectinesterase family protein contains ... 33 0.95 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 33 0.95 At5g23800.1 68418.m02794 agenet domain-containing protein contai... 32 1.3 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 32 1.3 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 32 1.3 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 32 1.7 At2g17480.1 68415.m02019 seven transmembrane MLO family protein ... 32 1.7 At2g47220.1 68415.m05897 3' exoribonuclease family domain 1 prot... 31 2.2 At2g24050.1 68415.m02873 MIF4G domain-containing protein / MA3 d... 31 2.2 At5g64910.1 68418.m08165 expressed protein ; expression support... 31 2.9 At3g54760.1 68416.m06059 dentin sialophosphoprotein-related cont... 31 2.9 At3g28830.1 68416.m03597 expressed protein 31 2.9 At1g24764.1 68414.m03106 expressed protein 31 2.9 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 31 3.8 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 31 3.8 At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 31 3.8 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 30 5.1 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 30 5.1 At1g30470.1 68414.m03724 SIT4 phosphatase-associated family prot... 30 5.1 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 30 6.7 At2g43970.2 68415.m05468 La domain-containing protein contains P... 30 6.7 At2g43970.1 68415.m05467 La domain-containing protein contains P... 30 6.7 At2g22795.1 68415.m02704 expressed protein 30 6.7 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 30 6.7 At5g63420.1 68418.m07962 metallo-beta-lactamase family protein 29 8.9 At5g62550.1 68418.m07850 expressed protein 29 8.9 At5g10500.1 68418.m01216 kinase interacting family protein simil... 29 8.9 At5g07820.1 68418.m00896 expressed protein 29 8.9 At4g12910.1 68417.m02019 serine carboxypeptidase S10 family prot... 29 8.9 At3g10530.1 68416.m01264 transducin family protein / WD-40 repea... 29 8.9 At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family pr... 29 8.9 At1g33500.1 68414.m04146 hypothetical protein 29 8.9 >At3g61690.1 68416.m06913 expressed protein Length = 1303 Score = 36.3 bits (80), Expect = 0.077 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 3/93 (3%) Query: 116 DWETNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAE--PQFSNKGPGRSS 173 +W R SG + +Q + + R + GSS R ++ S GP RS+ Sbjct: 1143 NWNAGSKTRGSGRNHNNRNQADNKPISRQDRSDRHWGSSYRHESSSYSAHHSQNGPIRSN 1202 Query: 174 TDRPKSGKVTKAKTSLPPN-KLNTYSISERNNL 205 T + SG + LPP K N+ + SE +N+ Sbjct: 1203 TSQDASGNIAYGMYRLPPGMKQNSVTSSEGHNV 1235 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 35.5 bits (78), Expect = 0.14 Identities = 32/120 (26%), Positives = 49/120 (40%), Gaps = 10/120 (8%) Query: 63 REKSLNYDSPRYFERASFQNANNVDSDYTRYYDESVG----SGDFIPLNSRKRSYQPDWE 118 R KS +Y SPR S + + SD R Y S G S + P R+R Y P Sbjct: 173 RHKSPSY-SPRRSVSCSRSRSRSYSSDRGRSYSPSYGRRGRSSSYSPFYRRRRFYSPSRS 231 Query: 119 TNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPK 178 +P+ R++ R D ++ RR +R + R P + + RS + P+ Sbjct: 232 PSPDDRYN---RRRDRSYSPYYRRRDRSRSYSRNCRARD--RSPYYMRRYRSRSRSYSPR 286 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 34.3 bits (75), Expect = 0.31 Identities = 40/126 (31%), Positives = 55/126 (43%), Gaps = 15/126 (11%) Query: 72 PRYF-ERASFQNANNVDSDYTRYYDESVGSGDFIPLNSRKRSYQPDWETNPNKRFSGNAR 130 PR++ +R +FQ+ N R Y E G F R+RS P + N+R +R Sbjct: 439 PRHWPDRRNFQDRNRDRYPSNRSYSERSPRGRFRS-PPRRRS-PPRY----NRRRRSTSR 492 Query: 131 GSDS-QFNFRSGRRSAN---RFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAK 186 D + R G RS + R + Q KRQP ++ S GP RS P G T Sbjct: 493 SPDGYRRRLRDGSRSQSPRHRSRSQSPRKRQPISQDLKSRLGPQRS----PIRGGRTSPA 548 Query: 187 TSLPPN 192 SL P+ Sbjct: 549 ESLSPS 554 >At3g62170.1 68416.m06985 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase, PF04043 plant invertase/pectin methylesterase inhibitor ;similar to pollen-specific pectin esterase GI:1620652 from [Brassica rapa subsp. pekinensis] Length = 588 Score = 32.7 bits (71), Expect = 0.95 Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 151 QGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKA 185 QG + A +F+N+GPG ++T RP KV K+ Sbjct: 524 QGEQNHKTAKYIEFNNRGPGAATTQRPPWVKVAKS 558 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 32.7 bits (71), Expect = 0.95 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 684 EKNDDVVVAPETT-ADKPVSELPNENKTVDTENNDESKANEQ 724 EK ++ V A + AD+PV E P E +T+ TE + E+ Sbjct: 1851 EKTEEYVEAQQDNEADEPVEESPTETETIPTEEESRDQTEEE 1892 Score = 30.7 bits (66), Expect = 3.8 Identities = 19/92 (20%), Positives = 35/92 (38%), Gaps = 4/92 (4%) Query: 684 EKNDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAKDVISNL--KS 741 E + + P + + + + T++T D+ ++ GD AEEA D+ +N + Sbjct: 1934 EVQPETLATPTQSPSRMETAMEEAETTIETPVEDDK--TDEGGDAAEEAADIPNNANDQQ 1991 Query: 742 EVPATPTRSSAXXXXXXXXXXXXXXXXXLAAA 773 E P T + LA+A Sbjct: 1992 EAPETDIKPETSAATTSPVSTAPTTSSTLASA 2023 >At5g23800.1 68418.m02794 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 552 Score = 32.3 bits (70), Expect = 1.3 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Query: 685 KNDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAK--DVISNLKSE 742 K D++ A + TA+K ++ NE K ++ + +E A E M+ E K + N+K E Sbjct: 476 KMDELKGAKKVTAEKESVKVENERKILELQRLNEEMAKEIAQSMSCEGKILQQLDNMKLE 535 Query: 743 VPAT 746 AT Sbjct: 536 FQAT 539 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 32.3 bits (70), Expect = 1.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 140 SGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDR 176 SG R A+RF+ Q ++ P+FSN+ P + T R Sbjct: 327 SGGRDASRFEPQSPNQHVNPQRPRFSNQAPNQQPTGR 363 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 32.3 bits (70), Expect = 1.3 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 155 KRQPAAEPQFSNKGPGRSSTDRPKSG-KVTKAKTSLPP--NKLNTYSI 199 K+ P A P+FSN GP S P VT+ K PP ++L++Y + Sbjct: 248 KQPPLAPPRFSNYGPPPSGPSAPVDAFLVTEYKPQAPPMGSRLSSYGV 295 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 31.9 bits (69), Expect = 1.7 Identities = 39/157 (24%), Positives = 60/157 (38%), Gaps = 12/157 (7%) Query: 42 LKRKRXXXXXXXXXXXXXXXHREKSLNYDSPRYFERASFQNANNVDSDYTRYYDESVGSG 101 +KRKR +S Y S Y +S + TR+ G Sbjct: 221 IKRKRRYSSSDSYSSSSDSDSDSESEAYSSSSYESSSSSDGKHRKRKSTTRHKGRR-GER 279 Query: 102 DFIPLNSRKRSYQPDWETNPNKRF-SGNARGSDSQFN--FRSGRRSAN---RFQGQGSSK 155 + +K++ +PD + + N + ++ SD + R G RS + R + Q K Sbjct: 280 KSKGRSGKKKA-RPDRKPSTNSSSDTESSSSSDDGYRRRLRDGSRSQSPRHRSRSQSPRK 338 Query: 156 RQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLPPN 192 RQP ++ S GP RS P G T SL P+ Sbjct: 339 RQPISQDLKSRLGPQRS----PIRGGRTSPAESLSPS 371 >At2g17480.1 68415.m02019 seven transmembrane MLO family protein / MLO-like protein 8 (MLO8) identical to membrane protein Mlo8 [Arabidopsis thaliana] gi|14091586|gb|AAK53801; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 593 Score = 31.9 bits (69), Expect = 1.7 Identities = 25/94 (26%), Positives = 35/94 (37%), Gaps = 2/94 (2%) Query: 123 KRFSGNARGSDSQFNFRSGR--RSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSG 180 KR G+ S + RS RS R++ S R +P+ S+ + PKS Sbjct: 489 KRLGGDGSASPTASTVRSTSSVRSLQRYKTTPHSMRYEGLDPETSDLDTDNEALTPPKSP 548 Query: 181 KVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAK 214 + + PNK NT S K S K Sbjct: 549 PSFELVVKVEPNKTNTGETSRDTETDSKEFSFVK 582 >At2g47220.1 68415.m05897 3' exoribonuclease family domain 1 protein-related similar to polynucleotide phosphorylase [Pisum sativum] GI:2286200, polyribonucleotide phophorylase [Spinacia oleracea] GI:1924972; contains Pfam profiles PF05266: Protein of unknown function (DUF724), weak hit to PF01138: 3' exoribonuclease family, domain 1 Length = 469 Score = 31.5 bits (68), Expect = 2.2 Identities = 26/111 (23%), Positives = 52/111 (46%), Gaps = 10/111 (9%) Query: 244 LKELKTKFSEVEAYRDTIQSPLAQRTVKQILRDRIKELMMNKYIGGINDGLTVYRKRYPE 303 L LK F+E+E + T+ +PL++ L+DR +++ + L V+ K + Sbjct: 354 LNSLKDSFTELEKHGFTVTAPLSRIAKLLALKDRQLKIL---------EELKVFDKEMKD 404 Query: 304 GTDEALLEEVKQAKEELNVKNPDNKLIQSDDPEAFLEKNLEKLIHSKLVEM 354 + + E + + E + NK+++ EA LEK + + K+ +M Sbjct: 405 ESSKKHKAEQEFGEMERKILEVKNKVLELQKQEAALEKQ-KDATYEKICKM 454 >At2g24050.1 68415.m02873 MIF4G domain-containing protein / MA3 domain-containing protein similar to SP|Q03387 Eukaryotic initiation factor (iso)4F subunit P82-34 (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 747 Score = 31.5 bits (68), Expect = 2.2 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 14/123 (11%) Query: 104 IPLNSRKRSYQPDWETNP--NKRFSGNAR----GSDSQFNFRSGRRSANRFQGQGSSKRQ 157 +P +R+ QP ++ P NK S N+R GS N G R + QG GSS Sbjct: 490 MPRGNRQTVQQPRFQPPPAINKSLSVNSRLLPQGSGGLLN--GGGRPSPLLQGNGSSSAP 547 Query: 158 PAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAKKVD 217 A++P + + P +P+S + + + N LN + + + + + + VD Sbjct: 548 QASKPIPTVEKP------QPRSQPQPQPQAAPLANSLNAGELERKTKSLLEEYFSIRLVD 601 Query: 218 ESL 220 E+L Sbjct: 602 EAL 604 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 31.1 bits (67), Expect = 2.9 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Query: 685 KNDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAKD 734 KNDD VV TT + ++ +T +TE+ ES A E+ G EEA + Sbjct: 29 KNDDAVVEATTTQETQPTQ-----ETEETEDKVESPAPEEEGKNEEEANE 73 >At3g54760.1 68416.m06059 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor (Dentin phosphophoryn DPP, Dentin sialoprotein DSP) [Homo sapiens] Length = 792 Score = 31.1 bits (67), Expect = 2.9 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Query: 686 NDDVVVAPETTADKPVSELPN-ENKTVDTENNDESKANEQTGDMAEEAKDVISNLKSEVP 744 N+ + T D P++E N E+ V DE K N DM + I + S +P Sbjct: 256 NESAGASMVQTQDVPIAEADNNESNVVKKMEIDERKDN---ADMTSDLTGTIESADSAIP 312 Query: 745 ATPTRSSA 752 +PT +A Sbjct: 313 NSPTEDAA 320 >At3g28830.1 68416.m03597 expressed protein Length = 539 Score = 31.1 bits (67), Expect = 2.9 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 3/95 (3%) Query: 126 SGNARGSDSQFNFRSGRRSAN-RFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTK 184 SG+ + S S SG+ S+ QGS+ Q +A Q S G +S R +SG + Sbjct: 282 SGSPKASPS--GSVSGKSSSKGSASAQGSASAQGSASAQGSASAQGSASAQRRESGAMAM 339 Query: 185 AKTSLPPNKLNTYSISERNNLVKKTTSAAKKVDES 219 +K+ S S + TT+ K ES Sbjct: 340 SKSRETKTSSQRQSKSSSESSSSSTTTTTVKQVES 374 >At1g24764.1 68414.m03106 expressed protein Length = 607 Score = 31.1 bits (67), Expect = 2.9 Identities = 37/156 (23%), Positives = 62/156 (39%), Gaps = 14/156 (8%) Query: 107 NSRKRSYQPDWETNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSN 166 +S++R +P ++ + F GSD + NR + + K + E Sbjct: 48 SSKRRPIRPSFDAAADNEFITLLHGSDPV------KVELNRLENEVRDKDRELGEANAEI 101 Query: 167 KGPGRSSTDRPKS-GKVTKAKTSLPPNKLNTYSISERNNLV-------KKTTSAAKKVDE 218 K S R K+ ++T+ T L T SI E NL KK + AA+ E Sbjct: 102 KALRLSERQREKAVEELTEELTKLDEKLKLTESILESKNLEIKKINEEKKASMAAQFAAE 161 Query: 219 SLILRPNCPMSNQLQGRLELVMGHLLKELKTKFSEV 254 + + R + + +E ++ L ELK SE+ Sbjct: 162 ATLRRVHAAQKDDDMPPIEAILAPLEAELKLARSEI 197 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 30.7 bits (66), Expect = 3.8 Identities = 27/112 (24%), Positives = 44/112 (39%), Gaps = 4/112 (3%) Query: 108 SRKRSYQPDWETNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNK 167 +R RS PD + R+ +R + RRS Q +S + + + SN+ Sbjct: 184 TRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNE 243 Query: 168 ---GPGRSSTDR-PKSGKVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAKK 215 P RS + R P K + +K P + N S S + + AA + Sbjct: 244 RSPSPRRSLSPRSPALQKASPSKEMSPERRSNERSPSPGSPAPLRKVDAASR 295 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 30.7 bits (66), Expect = 3.8 Identities = 27/112 (24%), Positives = 44/112 (39%), Gaps = 4/112 (3%) Query: 108 SRKRSYQPDWETNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNK 167 +R RS PD + R+ +R + RRS Q +S + + + SN+ Sbjct: 184 TRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNE 243 Query: 168 ---GPGRSSTDR-PKSGKVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAKK 215 P RS + R P K + +K P + N S S + + AA + Sbjct: 244 RSPSPRRSLSPRSPALQKASPSKEMSPERRSNERSPSPGSPAPLRKVDAASR 295 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 30.7 bits (66), Expect = 3.8 Identities = 21/104 (20%), Positives = 43/104 (41%), Gaps = 1/104 (0%) Query: 136 FNFRSGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLPPNKLN 195 F+ S R S N G+G + A S R RP +G+ +A + + Sbjct: 383 FSAASSRASENNSDGEGGGEWADAVGADESGNNRPRKRGRRPANGR-AEALNHVEAERQR 441 Query: 196 TYSISERNNLVKKTTSAAKKVDESLILRPNCPMSNQLQGRLELV 239 +++R ++ K+D++ +L N+L +L+++ Sbjct: 442 REKLNQRFYALRSVVPNISKMDKASLLGDAVSYINELHAKLKVM 485 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 30.3 bits (65), Expect = 5.1 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 686 NDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAKDVISNLKSEV 743 +DDV+ P T AD+P + + + + D E DE A +T ++ E K +++ + +V Sbjct: 433 DDDVLYKPPTKADQPDKKSFSPSNSSDEEEEDEMDA-ARTTEINMEIKRILTEVLLKV 489 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 30.3 bits (65), Expect = 5.1 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 686 NDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAEEAKDVISNLKSEV 743 +DDV+ P T AD+P + + + + D E DE A +T ++ E K +++ + +V Sbjct: 420 DDDVLYKPPTKADQPDKKSFSPSNSSDEEEEDEMDA-ARTTEINMEIKRILTEVLLKV 476 >At1g30470.1 68414.m03724 SIT4 phosphatase-associated family protein contains similarity to copper chaperone homolog CCH GB:AAF15286 GI:6525011 from [Glycine max]; contains Pfam profile PF04499: SIT4 phosphatase-associated protein Length = 811 Score = 30.3 bits (65), Expect = 5.1 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 686 NDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMAE-EAKDVISNLKSEVP 744 N V P D+ +LP+E+ TEN+ ++ E T + +V NL+ P Sbjct: 709 NKSAVKTPGVPGDETTEKLPDESGVEPTENSPKASGIEPTESSPKASGAEVTGNLRDSDP 768 Query: 745 A 745 A Sbjct: 769 A 769 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 29.9 bits (64), Expect = 6.7 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 6/105 (5%) Query: 89 DYTRYYDESVGSGDFIPLNSRKRSYQPDWETNPNKRFSGNARG---SDSQFNFRSGRRSA 145 DYT Y D D N+ Y E + + +RG S S+ RS RS Sbjct: 163 DYTSYEDMKYALDDTEFRNAFSHEYVRVREYDSRRDSRSPSRGRSYSKSRSRGRSPSRSR 222 Query: 146 NRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLP 190 +R + + S R P A+ + P +S++ P+S +K+++ P Sbjct: 223 SRSRSR-SKSRSPKAKS--LRRSPAKSTSRSPRSRSRSKSRSLSP 264 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 29.9 bits (64), Expect = 6.7 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Query: 87 DSDYTRYYDESVGSGDFIPLNSRKRSYQPDWETNPNKRFSGNARGSDSQFNFRSGRRSAN 146 D+D D++ S + P+ + +W+T+ ++ G +G++ R GR N Sbjct: 383 DADVEHEEDDATTS-EQQPIEKQSDDCSGEWDTHMQEQPIGEDQGNEKAAGQRKGR---N 438 Query: 147 RFQGQGSSKRQP 158 R +G+G + QP Sbjct: 439 RGRGKGRGRGQP 450 >At2g43970.1 68415.m05467 La domain-containing protein contains Pfam profile PF05383: La domain Length = 545 Score = 29.9 bits (64), Expect = 6.7 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Query: 87 DSDYTRYYDESVGSGDFIPLNSRKRSYQPDWETNPNKRFSGNARGSDSQFNFRSGRRSAN 146 D+D D++ S + P+ + +W+T+ ++ G +G++ R GR N Sbjct: 399 DADVEHEEDDATTS-EQQPIEKQSDDCSGEWDTHMQEQPIGEDQGNEKAAGQRKGR---N 454 Query: 147 RFQGQGSSKRQP 158 R +G+G + QP Sbjct: 455 RGRGKGRGRGQP 466 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 29.9 bits (64), Expect = 6.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query: 696 TADKPVSELPNENKTVDTENND--ESKANEQTGDMAEEAKDVISNLKSE 742 T DK S E+K +TE + ES + E+T D EAK+ + + E Sbjct: 435 TKDKEESSSQEESKDRETETKEKEESSSQEETMDKETEAKEKVESSSQE 483 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 29.9 bits (64), Expect = 6.7 Identities = 44/194 (22%), Positives = 82/194 (42%), Gaps = 14/194 (7%) Query: 155 KRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAK 214 K + A NK GRS K T K ++ K Y ISE ++ + A Sbjct: 8 KEKKARSDVVVNKASGRSKRSSGSRTKKTSNKVNIVKKKPEIYEISESSS--SDSVEEAI 65 Query: 215 KVDESLILRPNCPMSNQLQGRLELVMGHLLKELKTKFSEVEAYRDTIQSPLAQRTVKQIL 274 + DE+ + N +S + G+ +G K K + E + + + +++I+ Sbjct: 66 RGDEA--KKSNGVVSKRGNGK---SVGIPTKTSKNR-EEDDGGAEDAKIKFPMNRIRRIM 119 Query: 275 R-DRIKELMMNKYIGGINDGLTVYRKRYPEGTDEALLEEVKQAKEELNVKNPDNKLIQSD 333 R D +M + +N ++ +R+ E EA VK K+ ++ K+ + ++ +D Sbjct: 120 RSDNSAPQIMQDAVFLVNKATEMFIERFSE---EAYDSSVKDKKKFIHYKHL-SSVVSND 175 Query: 334 DPEAFLEKNL-EKL 346 FL ++ EKL Sbjct: 176 QRYEFLADSVPEKL 189 >At5g63420.1 68418.m07962 metallo-beta-lactamase family protein Length = 911 Score = 29.5 bits (63), Expect = 8.9 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 684 EKNDDVVVAPETTADKPV-SELPNENKTVDTENNDESKANEQTGDMAEEAKD 734 E++DD + + P SE N NK DTE E K N + D +A D Sbjct: 755 EESDDFWKSFINPSSSPSPSETENMNKVADTEPKAEGKENSRDDDELADASD 806 >At5g62550.1 68418.m07850 expressed protein Length = 487 Score = 29.5 bits (63), Expect = 8.9 Identities = 24/101 (23%), Positives = 40/101 (39%) Query: 118 ETNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRP 177 E + + SGN+ S ++ RS RS +S+T Sbjct: 6 EKSVSSAASGNSINSKLRYPLRSALRSKEGKPPVPDFSASSMPRRARVVSAVSQSTTVLD 65 Query: 178 KSGKVTKAKTSLPPNKLNTYSISERNNLVKKTTSAAKKVDE 218 SGK + +T LPP +L+ + N+ VK +S+ + E Sbjct: 66 LSGKKSVDRTKLPPRRLSIPNKPTSNSSVKSVSSSVTSLSE 106 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 29.5 bits (63), Expect = 8.9 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 680 KVPVEKNDDVVVAPETTADKPVSELPNENKTVDTENNDESKANEQTGDMA-EEAKDVISN 738 K P E DD VV+ K SE+ K + E N E +T + + + + IS+ Sbjct: 467 KFPEENIDDTVVSENALDIKSASEVVFAEKDLSDEVNQEEAIETKTKEASLSDLEKHISS 526 Query: 739 LKSEVPATPTRS 750 KS++ T S Sbjct: 527 PKSDIITTQESS 538 >At5g07820.1 68418.m00896 expressed protein Length = 561 Score = 29.5 bits (63), Expect = 8.9 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 292 DGLTVYRKRYPEGTDEALLEEVKQAKEELNVKNPDNKLIQSDDPEAFLEKNLEKLIHSKL 351 DGL V +K + T ++ V+ K+ V N +++ Q+ P+ L KNL+ K+ Sbjct: 151 DGLHV-KKSETKSTSPSVSPVVRTVKKTNLVVNKASRISQNKSPKEDLSKNLKNKEKGKI 209 Query: 352 VE 353 VE Sbjct: 210 VE 211 >At4g12910.1 68417.m02019 serine carboxypeptidase S10 family protein SERINE CARBOXYPEPTIDASE I PRECURSOR - Hordeum vulgare, SWall:CBP1_HORVU Length = 484 Score = 29.5 bits (63), Expect = 8.9 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 8/61 (13%) Query: 154 SKRQPAAEPQ--FSNKGPGRSSTDR------PKSGKVTKAKTSLPPNKLNTYSISERNNL 205 S++ P+ +P + N GPG SS D P + ++ K SLP LN YS S+ +N+ Sbjct: 71 SEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVSNI 130 Query: 206 V 206 + Sbjct: 131 I 131 >At3g10530.1 68416.m01264 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); BING4 (gi:3811380) {Mus musculus]; similar to hypothetical protein GB:P40055 [Saccharomyces cerevisiae] Length = 536 Score = 29.5 bits (63), Expect = 8.9 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Query: 139 RSGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLPPNKLNTYS 198 R RR +G+ ++++ A E S + ++ R K K TK K + N T+ Sbjct: 446 RPSRRKEKPSRGEIEAEKEVAIEAAKSTELKNKTK-GRNKPSKRTKKKKEMVENAKRTFP 504 Query: 199 ISERNNLVKK 208 E N +KK Sbjct: 505 EQEHNTAIKK 514 >At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 485 Score = 29.5 bits (63), Expect = 8.9 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 6/87 (6%) Query: 119 TNPNKRFSGNARGSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNKGP--GRSSTDR 176 T KR N+ + S + +S N + + ++ P + + SN G G+ S+D Sbjct: 235 TKKRKRNGQNSEAAQSHRSQQSEEEPDNNGDEKRNDEQSPNSPGKKSNSGKQQGKQSSDP 294 Query: 177 PKSGKV-TKAKTSLPPNKLNTYSISER 202 PK G + +A+ N++S++ER Sbjct: 295 PKDGYIHVRARRG---QATNSHSLAER 318 >At1g33500.1 68414.m04146 hypothetical protein Length = 254 Score = 29.5 bits (63), Expect = 8.9 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Query: 202 RNNLVKKTTSAAKKVDESLILRPNCPMSN-QLQGRLELVMGHLLKELKTKFSEVE 255 RNNL++ + SA K+D++ ++R N N +++ +E V H + E K + V+ Sbjct: 149 RNNLMELSDSARAKLDQAKLMRSNLLQENSKIKLSIENVK-HKINEFKPELMSVD 202 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.310 0.128 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,886,353 Number of Sequences: 28952 Number of extensions: 583135 Number of successful extensions: 1955 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 30 Number of HSP's that attempted gapping in prelim test: 1925 Number of HSP's gapped (non-prelim): 60 length of query: 777 length of database: 12,070,560 effective HSP length: 87 effective length of query: 690 effective length of database: 9,551,736 effective search space: 6590697840 effective search space used: 6590697840 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -