BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000102-TA|BGIBMGA000102-PA|undefined (777 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 29 0.14 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 27 0.77 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 27 0.77 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 27 0.77 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 5.4 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 23 7.2 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 29.1 bits (62), Expect = 0.14 Identities = 27/118 (22%), Positives = 42/118 (35%), Gaps = 1/118 (0%) Query: 131 GSDSQFNFRSGRRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVTKAKTSLP 190 GS +G R + Q + + + PG + RP T A TS P Sbjct: 177 GSTGTTTTSTGTRLLHGILSQHPQQHGLGVQNGYGRHLPGHAQMGRPSYTTATMATTSTP 236 Query: 191 -PNKLNTYSISERNNLVKKTTSAAKKVDESLILRPNCPMSNQLQGRLELVMGHLLKEL 247 L + V+ +TS+ D +L+L+ ++ LQ L HL L Sbjct: 237 GSGSLPASPADSGVSDVESSTSSGGNEDANLLLKARLNPNSSLQPSLASHHSHLSSAL 294 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 110 KRSYQPDWETNPNKRF-SGNARGSDSQFNFRSGRRSA 145 +R YQP + P++RF SG + S + RS R S+ Sbjct: 414 RRRYQPAFRCKPSQRFASGRYYSAYSLHHVRSSRESS 450 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 26.6 bits (56), Expect = 0.77 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Query: 125 FSGNARGSDSQFNFRSG-RRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVT 183 +S S SQ + S R++NR + G R+P+ + P S + K K Sbjct: 17 YSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALPQPISKRKDKEHKKK 76 Query: 184 KAKTSLPPN 192 K+KT L N Sbjct: 77 KSKTILAVN 85 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 26.6 bits (56), Expect = 0.77 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Query: 125 FSGNARGSDSQFNFRSG-RRSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGKVT 183 +S S SQ + S R++NR + G R+P+ + P S + K K Sbjct: 17 YSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEALPQPISKRKDKEHKKK 76 Query: 184 KAKTSLPPN 192 K+KT L N Sbjct: 77 KSKTILAVN 85 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Query: 138 FRSGR----RSANRFQGQGSSKRQPAAEPQFSNKGPGRSSTDRPKSGK 181 F+ GR + AN QGQ ++ +P ++ K RPK GK Sbjct: 992 FKRGRYTPPQPANAQQGQAQAQAKPQSQEANKPKPATGGKGTRPKRGK 1039 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 688 DVVVAPETTADKPVSELPNENKTVDTENNDESKA 721 D V PETT + ++ P + V NN E +A Sbjct: 18 DNVTMPETTPRRKKNKKPLPTECVFCRNNGEEEA 51 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.310 0.128 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,650 Number of Sequences: 429 Number of extensions: 7330 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 7 length of query: 777 length of database: 140,377 effective HSP length: 63 effective length of query: 714 effective length of database: 113,350 effective search space: 80931900 effective search space used: 80931900 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -