BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000100-TA|BGIBMGA000100-PA|undefined (203 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 27 0.079 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.42 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.42 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.42 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.42 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 0.42 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.42 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.42 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.56 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.9 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 6.9 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.9 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.9 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.1 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 9.1 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 27.5 bits (58), Expect = 0.079 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSNKSGNQSLTSQGPGNYDKG 139 K SS + ++ P+ +HN G NS+N + P++ N S +QG + + Sbjct: 356 KRSSDEQQWRNNQPST--SNNRWHNNNGNNSNNHWRKNNPNDNRNNTSSRAQGETSRNSK 413 Query: 140 PYGSQG 145 G+ G Sbjct: 414 NSGNGG 419 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 112 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 152 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.42 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDHKIGYPSN 121 K ++S Q S PA T+ GTN++N K G SN Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNS-KSGQSSN 196 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.56 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSN 112 K ++S T Q S PA T+ GTN++N Sbjct: 156 KPATSTTSQNLSSPASSTSSTSSTEKAGTNNNN 188 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 1.7 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 178 NQNQWGNKVRKKMCYKQC 195 NQ +W N +R + + C Sbjct: 180 NQQRWQNSIRHSLSFNDC 197 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 111 SNDHKIGYPSNKSGNQSLTSQGPG 134 +N+ ++G P G + +Q PG Sbjct: 429 TNETQVGAPIKGPGREGFYTQNPG 452 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 62 LNGFRFGDKYIIKVEQVCKSSSSNTKQTDSGPADRYQ 98 L GF F KY VE++ ++ ++ RY+ Sbjct: 38 LEGFNFWGKYQKAVEKLLTEQKELAEKEEAETLKRYK 74 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 62 LNGFRFGDKYIIKVEQVCKSSSSNTKQTDSGPADRYQ 98 L GF F KY VE++ ++ ++ RY+ Sbjct: 198 LEGFNFWGKYQKAVEKLLTEQKELAEKEEAETLKRYK 234 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 6.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 62 LNGFRFGDKYIIKVEQVCKSSSSNTKQTDSGPADRYQ 98 L GF F KY VE++ ++ ++ RY+ Sbjct: 198 LEGFNFWGKYQKAVEKLLTEQKELAEKEEAETLKRYK 234 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 20.6 bits (41), Expect = 9.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 82 SSSNTKQTDSGPADRYQPTNYHNYPGTNSS 111 S+SN T S D Y ++ N+ ++SS Sbjct: 32 STSNYLYTPSSTIDLYNTSSVSNFNESSSS 61 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 20.6 bits (41), Expect = 9.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 82 SSSNTKQTDSGPADRYQPTNYHNYPGTNSS 111 S+SN T S D Y ++ N+ ++SS Sbjct: 32 STSNYLYTPSSTIDLYNTSSVSNFNESSSS 61 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/35 (25%), Positives = 19/35 (54%) Query: 80 KSSSSNTKQTDSGPADRYQPTNYHNYPGTNSSNDH 114 KSS S++ + + P D + ++ +Y +S D+ Sbjct: 131 KSSESDSGASSADPDDELRSSSAFSYIKPSSERDY 165 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.131 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,102 Number of Sequences: 317 Number of extensions: 2341 Number of successful extensions: 18 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of query: 203 length of database: 114,650 effective HSP length: 54 effective length of query: 149 effective length of database: 97,532 effective search space: 14532268 effective search space used: 14532268 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -