BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000098-TA|BGIBMGA000098-PA|undefined (299 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003756-1|AAO41435.1| 674|Drosophila melanogaster RE71343p pro... 31 2.5 AY089551-1|AAL90289.1| 975|Drosophila melanogaster LD28793p pro... 31 2.5 AE014297-4212|AAF56769.1| 975|Drosophila melanogaster CG4849-PA... 31 2.5 >BT003756-1|AAO41435.1| 674|Drosophila melanogaster RE71343p protein. Length = 674 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 136 ILRSVNPN-QMQQYRQIDYNDTVFTPQQIRGTNIRNDGPTLNLLD 179 ++R +P + + RQ+ Y DT+FT Q+ RG +I+ TL L D Sbjct: 151 LIRQTHPQFETMEERQLRYTDTLFTEQE-RGCSIKATPVTLVLQD 194 >AY089551-1|AAL90289.1| 975|Drosophila melanogaster LD28793p protein. Length = 975 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 136 ILRSVNPN-QMQQYRQIDYNDTVFTPQQIRGTNIRNDGPTLNLLD 179 ++R +P + + RQ+ Y DT+FT Q+ RG +I+ TL L D Sbjct: 151 LIRQTHPQFETMEERQLRYTDTLFTEQE-RGCSIKATPVTLVLQD 194 >AE014297-4212|AAF56769.1| 975|Drosophila melanogaster CG4849-PA protein. Length = 975 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 136 ILRSVNPN-QMQQYRQIDYNDTVFTPQQIRGTNIRNDGPTLNLLD 179 ++R +P + + RQ+ Y DT+FT Q+ RG +I+ TL L D Sbjct: 151 LIRQTHPQFETMEERQLRYTDTLFTEQE-RGCSIKATPVTLVLQD 194 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,085,257 Number of Sequences: 52641 Number of extensions: 565724 Number of successful extensions: 1287 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 1287 Number of HSP's gapped (non-prelim): 3 length of query: 299 length of database: 24,830,863 effective HSP length: 85 effective length of query: 214 effective length of database: 20,356,378 effective search space: 4356264892 effective search space used: 4356264892 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -