BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000098-TA|BGIBMGA000098-PA|undefined (299 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycop... 31 6.5 BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycop... 31 6.5 BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycop... 31 6.5 BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycop... 31 6.5 >BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.7 bits (66), Expect = 6.5 Identities = 20/77 (25%), Positives = 36/77 (46%) Query: 3 NSEKENKITETPMEDENNEEPDWPHIPKFKKHKGRLVSEMRELMYGYAQHRRMDIYKRLL 62 + E ++ TE ED+ E ++ IP + K +VS + Y R ++ +R Sbjct: 71 DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRAD 130 Query: 63 QVELCRNIALIHEENGY 79 + EL + LI +E G+ Sbjct: 131 EEELAQQYELIIQECGH 147 >BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.7 bits (66), Expect = 6.5 Identities = 20/77 (25%), Positives = 36/77 (46%) Query: 3 NSEKENKITETPMEDENNEEPDWPHIPKFKKHKGRLVSEMRELMYGYAQHRRMDIYKRLL 62 + E ++ TE ED+ E ++ IP + K +VS + Y R ++ +R Sbjct: 71 DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRAD 130 Query: 63 QVELCRNIALIHEENGY 79 + EL + LI +E G+ Sbjct: 131 EEELAQQYELIIQECGH 147 >BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.7 bits (66), Expect = 6.5 Identities = 20/77 (25%), Positives = 36/77 (46%) Query: 3 NSEKENKITETPMEDENNEEPDWPHIPKFKKHKGRLVSEMRELMYGYAQHRRMDIYKRLL 62 + E ++ TE ED+ E ++ IP + K +VS + Y R ++ +R Sbjct: 71 DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRAD 130 Query: 63 QVELCRNIALIHEENGY 79 + EL + LI +E G+ Sbjct: 131 EEELAQQYELIIQECGH 147 >BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 30.7 bits (66), Expect = 6.5 Identities = 20/77 (25%), Positives = 36/77 (46%) Query: 3 NSEKENKITETPMEDENNEEPDWPHIPKFKKHKGRLVSEMRELMYGYAQHRRMDIYKRLL 62 + E ++ TE ED+ E ++ IP + K +VS + Y R ++ +R Sbjct: 71 DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRAD 130 Query: 63 QVELCRNIALIHEENGY 79 + EL + LI +E G+ Sbjct: 131 EEELAQQYELIIQECGH 147 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,040,599 Number of Sequences: 224733 Number of extensions: 1445350 Number of successful extensions: 3355 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3351 Number of HSP's gapped (non-prelim): 4 length of query: 299 length of database: 73,234,838 effective HSP length: 90 effective length of query: 209 effective length of database: 53,008,868 effective search space: 11078853412 effective search space used: 11078853412 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -