BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000097-TA|BGIBMGA000097-PA|IPR001300|Peptidase C2, calpain, IPR002048|Calcium-binding EF-hand, IPR000169|Peptidase, cysteine peptidase active site (940 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 26 1.4 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 24 4.2 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 7.4 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 25.8 bits (54), Expect = 1.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Query: 795 LNQPQPYANAQELQGQGFSKDVCRSMIAMLDKDGSGGLGFEEFKSLWI 842 LN P + E+Q QG SK+ + D D S G+ F+ S+++ Sbjct: 425 LNYPGITVSNIEVQSQGSSKNTFNTFWQQSDVDLSRGMDFQPRGSVFV 472 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 145 VTLTQERDVPPPKKSSIVVQHK 166 V L +R++P PK+SS ++ K Sbjct: 69 VALPPKREIPSPKRSSPILAEK 90 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 79 RPKVADHNTPDEPKR 93 RP+ DH +EPKR Sbjct: 317 RPRATDHQRRNEPKR 331 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,393 Number of Sequences: 317 Number of extensions: 11215 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 4 length of query: 940 length of database: 114,650 effective HSP length: 63 effective length of query: 877 effective length of database: 94,679 effective search space: 83033483 effective search space used: 83033483 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -