BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000096-TA|BGIBMGA000096-PA|undefined (69 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 24 2.8 SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|ch... 23 5.0 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 23.8 bits (49), Expect = 2.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Query: 39 NIINEVFQKKEVEQKRFLP-SIKN 61 NI+ V K ++EQK LP ++KN Sbjct: 204 NIVGRVADKLQLEQKSVLPNAVKN 227 >SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 23.0 bits (47), Expect = 5.0 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 35 QALGNIINEVFQKKEVEQKRFLPS-IKNYKVVSII 68 QAL IIN V + +++K F IK ++ VS++ Sbjct: 444 QALDEIINSVKSSQNMKEKGFYSDVIKLHEEVSLL 478 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.138 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,275 Number of Sequences: 5004 Number of extensions: 4533 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 69 length of database: 2,362,478 effective HSP length: 49 effective length of query: 20 effective length of database: 2,117,282 effective search space: 42345640 effective search space used: 42345640 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -