SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000096-TA|BGIBMGA000096-PA|undefined
         (69 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_06_0130 - 11055305-11055593,11055666-11055949,11057271-110573...    26   4.3  

>10_06_0130 -
           11055305-11055593,11055666-11055949,11057271-11057398,
           11058522-11058606,11058917-11060872
          Length = 913

 Score = 25.8 bits (54), Expect = 4.3
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 32  YGAQALGNIINEVFQKKEVEQKRFLPSIKNYKVV 65
           +G   LG I + V   +E+E+K F P++  Y +V
Sbjct: 354 HGLCKLGRIGSAVRLLREMEKKGFAPNVVTYTIV 387


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.138    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,524,182
Number of Sequences: 37544
Number of extensions: 29536
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 39
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 14,793,348
effective HSP length: 49
effective length of query: 20
effective length of database: 12,953,692
effective search space: 259073840
effective search space used: 259073840
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -