BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000096-TA|BGIBMGA000096-PA|undefined (69 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0130 - 11055305-11055593,11055666-11055949,11057271-110573... 26 4.3 >10_06_0130 - 11055305-11055593,11055666-11055949,11057271-11057398, 11058522-11058606,11058917-11060872 Length = 913 Score = 25.8 bits (54), Expect = 4.3 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 32 YGAQALGNIINEVFQKKEVEQKRFLPSIKNYKVV 65 +G LG I + V +E+E+K F P++ Y +V Sbjct: 354 HGLCKLGRIGSAVRLLREMEKKGFAPNVVTYTIV 387 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.138 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,524,182 Number of Sequences: 37544 Number of extensions: 29536 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 39 Number of HSP's gapped (non-prelim): 1 length of query: 69 length of database: 14,793,348 effective HSP length: 49 effective length of query: 20 effective length of database: 12,953,692 effective search space: 259073840 effective search space used: 259073840 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -