BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000095-TA|BGIBMGA000095-PA|undefined (114 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02940.1 68417.m00401 oxidoreductase, 2OG-Fe(II) oxygenase fa... 25 9.2 At1g50020.1 68414.m05613 expressed protein 25 9.2 >At4g02940.1 68417.m00401 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to A. thaliana hypothetical protein T13L16.2, GenBank accession number 2708738; contains Pfam domain PF03171 2OG-Fe(II) oxygenase superfamily Length = 569 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 26 VKGFLNKERGEGSSEPLIGNGSLYPKLPSEDDAS 59 +KGF KE+ +G + ++ LY +L ED+ S Sbjct: 222 IKGFQAKEQVKGHTVNVVKGLKLYEELLKEDEIS 255 >At1g50020.1 68414.m05613 expressed protein Length = 209 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 12 NGWGWHRTANAAAAVKGFLNKERGEGSSEPL 42 N WHR +++A+ G N+ +GE E L Sbjct: 38 NSRSWHRLRVSSSALNGGDNQSKGEEPPESL 68 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.133 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,400,232 Number of Sequences: 28952 Number of extensions: 77409 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 117 Number of HSP's gapped (non-prelim): 2 length of query: 114 length of database: 12,070,560 effective HSP length: 72 effective length of query: 42 effective length of database: 9,986,016 effective search space: 419412672 effective search space used: 419412672 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -