BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000095-TA|BGIBMGA000095-PA|undefined (114 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 0.67 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 20 6.3 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 23.4 bits (48), Expect = 0.67 Identities = 12/43 (27%), Positives = 20/43 (46%) Query: 7 KNFKANGWGWHRTANAAAAVKGFLNKERGEGSSEPLIGNGSLY 49 K F W + T + + GFL K + + E ++G S+Y Sbjct: 4 KFFVGGNWKMNGTKSEINDIVGFLKKGPLDSNVEVVVGVPSIY 46 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 20.2 bits (40), Expect = 6.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 8 NFKANGWGWHRTANAAAAVKGFLNKERGEGSSEPLI 43 N K N H T++++AA L RG SS+ ++ Sbjct: 404 NCKINRKVHHTTSSSSAAGGEGLADRRGSESSDSVL 439 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.313 0.133 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,111 Number of Sequences: 429 Number of extensions: 732 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 114 length of database: 140,377 effective HSP length: 50 effective length of query: 64 effective length of database: 118,927 effective search space: 7611328 effective search space used: 7611328 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.5 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -