BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000093-TA|BGIBMGA000093-PA|IPR000276|Rhodopsin-like GPCR superfamily (178 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 33 0.001 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 33 0.001 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 1.1 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 1.1 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 3.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 4.4 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 33.1 bits (72), Expect = 0.001 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 71 LLATTTVANTLIVVVLSRRHMRTPT--NAVLMAMALCDMFTMLFPAP 115 L+ + +ANT ++V++ +R +TP+ N +LM +A+ D+ P Sbjct: 62 LMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIADLLVTFLMMP 108 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 33.1 bits (72), Expect = 0.001 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 71 LLATTTVANTLIVVVLSRRHMRTPT--NAVLMAMALCDMFTMLFPAP 115 L+ + +ANT ++V++ +R +TP+ N +LM +A+ D+ P Sbjct: 62 LMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIADLLVTFLMMP 108 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 7 NSTNDFEFQKP-FNYSINENITYFDYTNFTSDDFC 40 ++ + ++F P FN++ N Y +Y N+ C Sbjct: 199 DTESSYQFNDPQFNFNYQYNQAYSNYNNYQEGFSC 233 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 7 NSTNDFEFQKP-FNYSINENITYFDYTNFTSDDFC 40 ++ + ++F P FN++ N Y +Y N+ C Sbjct: 219 DTESSYQFNDPQFNFNYQYNQAYSNYNNYQEGFSC 253 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.8 bits (44), Expect = 3.3 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Query: 33 NFTSDDFCASNNSHVYLNVTCEFAISYAEPMYGYIAPFLLATTTVAN 79 N+T++ + +SH Y +A +YA YG + P L + T N Sbjct: 285 NWTANGHGHNTSSHNY------YAQNYAPTYYGQMQPDYLNSQTTQN 325 Score = 21.4 bits (43), Expect = 4.4 Identities = 11/44 (25%), Positives = 19/44 (43%) Query: 129 PLSPVRACQAWNYMNEARPREREMGRLFMMLMQCDVTPRAYSQT 172 PL V Q ++Y PR++ R Q D+ +++T Sbjct: 106 PLESVPFPQVYSYFAGVNPRKQRRERTTFTRAQLDLLEGLFAKT 149 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 14 FQKPFNYSINENITYFDYTNFTSDD 38 ++ P NY I +++ N SDD Sbjct: 405 YKLPPNYEIRHKFKLWNFNNQISDD 429 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.327 0.135 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,633 Number of Sequences: 317 Number of extensions: 2039 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 7 length of query: 178 length of database: 114,650 effective HSP length: 53 effective length of query: 125 effective length of database: 97,849 effective search space: 12231125 effective search space used: 12231125 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -