BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000092-TA|BGIBMGA000092-PA|IPR007243|Autophagy protein Apg6, IPR013819|Lipoxygenase, C-terminal (427 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 5.5 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 5.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 7.2 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 22 7.2 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 7.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 9.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 5.5 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Query: 347 LDCLQQFKEQVEMGNTGFCLPYRIDKGKIEDTASPPHAYSIKIQFNSEEHWTKALKYMLT 406 L C + G + L + G+I A+ Y +++ ++E K + YM T Sbjct: 586 LSCAENMMFDPMSGKCEYSLGEKCRPGQIIQVANSLRQYEDLLEYEAKEEGPKVVCYM-T 644 Query: 407 NLKWA 411 N WA Sbjct: 645 N--WA 647 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.6 bits (46), Expect = 5.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Query: 274 DWSEINAAWGQTVLLLSSLARKINF 298 +W ++ AW + LL+ +L + NF Sbjct: 417 EWPQLMKAWLKIELLVGNLGMRRNF 441 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 7.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 41 RRNNEADLDLQSSSLDHYV 59 RRN E+ + QSSSL ++ Sbjct: 333 RRNRESTTNTQSSSLSEFL 351 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 22.2 bits (45), Expect = 7.2 Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 411 ALTWISSQFCEDKSE 425 A+ WI+S+ CE+ S+ Sbjct: 340 AIVWITSETCEEVSK 354 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 7.2 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Query: 367 PYRIDKGKIEDTASPPHAYSIKIQFNSEEHWTKALKYMLTNLKWALTWISSQ 418 PY + + K + PPH Y N +H +A Y ++ TW + Q Sbjct: 267 PYPMQRPKSASLSPPPHVY------NPPDHIQQATPYSAPGPTYS-TWSTVQ 311 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 18 PLKLDDSLNNLGEHTIADLTLQIRRNNEADLDLQSS 53 P + + N E DL++++ +NN+ LDL + Sbjct: 280 PFTIVEPKLNKHEDLPQDLSMKLSKNNDQCLDLSKT 315 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 18 PLKLDDSLNNLGEHTIADLTLQIRRNNEADLDLQSS 53 P + + N E DL++++ +NN+ LDL + Sbjct: 172 PFTIVEPKLNKHEDLPQDLSMKLSKNNDQCLDLSKT 207 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.133 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,207 Number of Sequences: 317 Number of extensions: 3691 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 427 length of database: 114,650 effective HSP length: 59 effective length of query: 368 effective length of database: 95,947 effective search space: 35308496 effective search space used: 35308496 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -