BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000091-TA|BGIBMGA000091-PA|IPR001356|Homeobox, IPR009057|Homeodomain-like, IPR000047|Helix-turn-helix motif, lambda-like repressor (368 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0224 - 1662818-1663033,1663183-1663266,1663315-1663434,166... 50 4e-06 03_05_0645 - 26381559-26381819,26381899-26382105 48 1e-05 03_05_0648 - 26403249-26403357,26405142-26405284,26405425-264056... 46 4e-05 02_01_0617 + 4625564-4625887,4626824-4626944,4627643-4627833,462... 46 5e-05 07_01_0214 + 1595917-1596526,1597127-1597140,1598414-1598743,159... 45 8e-05 05_05_0075 + 22209322-22210041,22210323-22210391,22210775-222111... 45 1e-04 03_01_0163 + 1323296-1323457,1323994-1324125,1324375-1324508,132... 45 1e-04 01_02_0105 + 11171422-11171667,11171923-11172111 45 1e-04 06_03_0929 - 26028345-26028390,26028474-26028610,26028695-260288... 44 1e-04 01_06_1342 - 36438869-36439459,36439567-36439627,36440751-364411... 44 1e-04 12_02_1245 - 27308143-27308787,27308923-27308983,27309064-273094... 42 6e-04 03_05_0696 - 26856413-26856416,26857917-26858524,26859041-268591... 42 6e-04 11_01_0371 - 2821224-2822036,2822162-2822222,2823755-2824158 41 0.001 01_06_0040 - 25874308-25874611,25875743-25875822,25876764-258769... 41 0.002 10_08_0749 - 20282982-20283632,20284081-20284141,20284828-202848... 40 0.002 03_01_0167 + 1374578-1375243,1375895-1376277,1377947-1378007,137... 40 0.002 06_01_0061 + 527417-527856,527957-528017,528113-528685 40 0.003 03_01_0456 - 3495537-3496205,3496304-3496364,3496447-3496829,349... 40 0.003 06_01_0292 + 2136637-2137050,2137162-2137671 39 0.006 06_01_0290 + 2122758-2123015,2123128-2123544 39 0.007 03_06_0116 + 31773295-31773603,31773800-31773946,31774080-317741... 38 0.010 04_04_0710 - 27453135-27453480,27453647-27453726,27453893-274541... 38 0.013 03_06_0114 + 31751471-31751785,31751919-31752056,31752183-317522... 38 0.013 03_05_0982 - 29394513-29394719,29395314-29395327,29395652-293956... 38 0.013 05_07_0112 - 27755604-27756449,27756624-27756887,27757428-277575... 37 0.022 02_05_0618 + 30400338-30400452,30400553-30400692,30400805-304010... 37 0.022 02_05_0134 + 26161904-26162776 37 0.022 02_01_0380 + 2757691-2758080,2758389-2758712 37 0.030 10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 36 0.039 03_05_0985 - 29424698-29425183 36 0.039 02_04_0278 - 21507288-21507726,21507893-21507972,21508587-215088... 36 0.039 01_06_0968 + 33466574-33466607,33467087-33467115,33467438-334675... 36 0.052 01_06_0212 + 27575406-27575604,27575723-27576241,27576371-27576387 36 0.052 09_03_0144 - 12728697-12729238,12729312-12729432 36 0.068 08_02_0670 - 19877091-19877618,19880033-19880436,19880505-19880622 36 0.068 07_03_1291 + 25545749-25546262,25546989-25547669,25547693-255477... 36 0.068 06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720,673... 36 0.068 04_04_0667 + 27097741-27098085,27098203-27098547 36 0.068 03_01_0630 + 4635297-4636220 36 0.068 10_07_0134 + 13289641-13290216,13290435-13290914 35 0.12 09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 35 0.12 08_02_1031 - 23796755-23797171,23797243-23797595,23797676-23797715 35 0.12 03_02_0256 + 6899424-6899876,6900084-6900163,6900475-6900820 35 0.12 03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 35 0.12 09_06_0034 + 20370672-20371109,20371120-20371515 34 0.16 09_04_0318 - 16620177-16620582,16620686-16620765,16620873-166212... 34 0.21 01_06_0864 - 32546696-32546803,32546881-32546961,32547134-325472... 34 0.21 06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876,440... 33 0.48 11_06_0151 - 20643032-20643085,20643202-20643307,20643415-206434... 32 0.64 10_08_1025 - 22391267-22391767,22392641-22392736,22392838-223931... 32 0.64 08_02_1371 + 26493981-26494471,26497374-26497504,26497947-26498692 32 0.64 07_03_0126 - 13797395-13797451,13797590-13797707,13797802-13798004 31 1.1 02_05_0286 - 27506925-27507278,27508439-27508812,27509041-275092... 31 1.1 04_04_0841 - 28574497-28574883,28575815-28576188,28576262-285764... 31 1.5 10_06_0180 + 11526139-11526172,11526365-11527218 31 1.9 09_06_0020 - 20267190-20267612,20269086-20269495,20269573-202697... 31 1.9 08_01_0246 - 2028701-2029060,2029149-2030606,2030729-2031160 31 1.9 06_03_0671 + 23348958-23349101,23349475-23349834,23350003-233503... 31 1.9 06_03_1261 - 28814617-28814890,28814989-28815068,28815287-28815703 30 2.6 05_07_0225 + 28510996-28511080,28511184-28511437,28512964-285130... 30 2.6 08_02_0940 - 22822391-22822781,22822875-22823053,22823079-228234... 30 3.4 01_06_1818 - 40093327-40093384,40093501-40093580,40093661-400939... 30 3.4 03_02_0033 - 5148513-5148806,5148928-5149271,5149391-5149472 29 4.5 06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240... 29 5.9 06_01_0653 - 4720913-4721152,4721898-4721966,4722059-4722124,472... 29 5.9 04_04_1462 - 33769122-33769151,33769385-33769426,33769571-337701... 29 5.9 04_04_1231 - 31934745-31935125,31935230-31935325,31936215-319362... 29 5.9 08_01_0574 + 5103466-5103534,5104526-5104806,5104959-5105127 29 7.8 06_01_0741 - 5510159-5510581,5510862-5511124,5511223-5511400,551... 29 7.8 05_03_0501 + 14744913-14745107,14745545-14745571,14746002-147460... 29 7.8 01_06_1142 + 34856497-34856698,34857852-34858402 29 7.8 >05_01_0224 - 1662818-1663033,1663183-1663266,1663315-1663434, 1664527-1664655,1664743-1664988 Length = 264 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 5/71 (7%) Query: 276 SRNALKD---CYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEML 332 +R+AL D +YR YPT ++K LA TGL Q++NWF N+R+R P + R ++ Sbjct: 64 ARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKPSEDMRFALM 123 Query: 333 VPAQYAGPQGG 343 A GP GG Sbjct: 124 EGA--CGPVGG 132 >03_05_0645 - 26381559-26381819,26381899-26382105 Length = 155 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/65 (43%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRP-EMLVPAQYAGPQG 342 +YR YP+ EK ALA+ TGL Q++NWF N+R+R P P L PA A G Sbjct: 62 HYRWPYPSELEKAALAESTGLDAKQINNWFINQRKRHWKPTPPAMEYRSLQPAGAASYGG 121 Query: 343 GLAQA 347 A A Sbjct: 122 ASAGA 126 >03_05_0648 - 26403249-26403357,26405142-26405284,26405425-26405675, 26405707-26405713 Length = 169 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/41 (51%), Positives = 28/41 (68%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 +YR YP+ EK ALA+ TGL QV+NWF N+R+R P+ Sbjct: 79 HYRWPYPSEAEKAALAESTGLDKKQVTNWFINQRKRHWKPK 119 >02_01_0617 + 4625564-4625887,4626824-4626944,4627643-4627833, 4627910-4628041,4628132-4628269 Length = 301 Score = 46.0 bits (104), Expect = 5e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Query: 289 YPTPDEKRALAQKTGLTLTQVSNWFKNRRQRD 320 YPT D+K L Q+TGL L Q++NWF N+R+R+ Sbjct: 254 YPTEDDKARLVQETGLQLKQINNWFINQRKRN 285 >07_01_0214 + 1595917-1596526,1597127-1597140,1598414-1598743, 1598853-1598963,1599113-1599269,1603366-1603619, 1603762-1603960,1604341-1604498 Length = 610 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/44 (43%), Positives = 29/44 (65%) Query: 282 DCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQ 325 + +Y+ YP+ EK ALA+ TGL Q++NWF N+R+R P + Sbjct: 483 ELHYKWPYPSETEKIALAESTGLDQKQINNWFINQRKRHWKPSE 526 >05_05_0075 + 22209322-22210041,22210323-22210391,22210775-22211145, 22212291-22212351,22212496-22213086 Length = 603 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/36 (52%), Positives = 26/36 (72%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YPT +K+ LA++TGLT QVSNWF N R R Sbjct: 383 HFLHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVR 418 >03_01_0163 + 1323296-1323457,1323994-1324125,1324375-1324508, 1324618-1324621 Length = 143 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Query: 289 YPTPDEKRALAQKTGLTLTQVSNWFKNRRQRD 320 YPT D+K L ++TGL L Q++NWF N+R+R+ Sbjct: 96 YPTEDDKAKLVEETGLQLKQINNWFINQRKRN 127 >01_02_0105 + 11171422-11171667,11171923-11172111 Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/45 (44%), Positives = 28/45 (62%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNR 328 +YR YPT ++K LA +TGL Q++NWF N+R+R P R Sbjct: 75 HYRWPYPTEEDKLRLAARTGLDPKQINNWFINQRKRHWKPSDGMR 119 >06_03_0929 - 26028345-26028390,26028474-26028610,26028695-26028826, 26028901-26029109,26029554-26029674,26030730-26031080 Length = 331 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Query: 289 YPTPDEKRALAQKTGLTLTQVSNWFKNRRQRD 320 YPT ++K L Q+TGL L Q++NWF N+R+R+ Sbjct: 269 YPTEEDKARLVQETGLQLKQINNWFINQRKRN 300 >01_06_1342 - 36438869-36439459,36439567-36439627,36440751-36441130, 36441955-36442761 Length = 612 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/36 (52%), Positives = 26/36 (72%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YPT +K+ LA++TGLT QVSNWF N R R Sbjct: 392 HFLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 427 >12_02_1245 - 27308143-27308787,27308923-27308983,27309064-27309440, 27309657-27310517 Length = 647 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP EK LA++TGLT +Q+SNWF N R R Sbjct: 409 HFLHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 444 >03_05_0696 - 26856413-26856416,26857917-26858524,26859041-26859101, 26859181-26859557,26860314-26861156 Length = 630 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP EK LA++TGLT +Q+SNWF N R R Sbjct: 403 HFLHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 438 >11_01_0371 - 2821224-2822036,2822162-2822222,2823755-2824158 Length = 425 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP +K LA++TGLT +QVSNWF N R R Sbjct: 131 HFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 166 >01_06_0040 - 25874308-25874611,25875743-25875822,25876764-25876996, 25877285-25877354 Length = 228 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEML 332 KE+SR L++ + N TP +K ALA K L QV WF+NRR R + Q E L Sbjct: 83 KEQSR-LLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKQTEMECEYL 141 >10_08_0749 - 20282982-20283632,20284081-20284141,20284828-20284872, 20285293-20285672,20286382-20287050 Length = 601 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/32 (53%), Positives = 24/32 (75%) Query: 288 RYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 RYP+ +K LA++TGL+ +QV+NWF N R R Sbjct: 365 RYPSDVDKHILARQTGLSRSQVANWFINARVR 396 >03_01_0167 + 1374578-1375243,1375895-1376277,1377947-1378007, 1378721-1379386 Length = 591 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 26/36 (72%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP+ +K LA++TGL+ +QVSNWF N R R Sbjct: 346 HFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 381 >06_01_0061 + 527417-527856,527957-528017,528113-528685 Length = 357 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/36 (47%), Positives = 25/36 (69%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP +K LA++TGL+ +QVSNWF N R R Sbjct: 143 HFLHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 178 >03_01_0456 - 3495537-3496205,3496304-3496364,3496447-3496829, 3496924-3497613 Length = 600 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 284 YYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQR 319 ++ + YP EK LA++TGL+ QVSNWF N R R Sbjct: 354 HFLHPYPKDSEKLMLARQTGLSRGQVSNWFINARVR 389 >06_01_0292 + 2136637-2137050,2137162-2137671 Length = 307 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/45 (40%), Positives = 26/45 (57%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 L++C+ + P +K ALA + GL QV WF+NRR R + Q Sbjct: 126 LEECFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQ 170 >06_01_0290 + 2122758-2123015,2123128-2123544 Length = 224 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/45 (40%), Positives = 26/45 (57%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 L++C+ + TP +K ALA+ L QV WF+NRR R + Q Sbjct: 74 LEECFKTHHTLTPKQKVALAKSLNLRPRQVEVWFQNRRARTKLKQ 118 >03_06_0116 + 31773295-31773603,31773800-31773946,31774080-31774158, 31777558-31778180 Length = 385 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/35 (51%), Positives = 21/35 (60%) Query: 289 YPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTP 323 Y EK LAQ TGL Q+SNWF N+R+R P Sbjct: 296 YEQEVEKMTLAQTTGLDQKQISNWFINQRKRHWKP 330 >04_04_0710 - 27453135-27453480,27453647-27453726,27453893-27454107, 27454227-27454329 Length = 247 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/61 (32%), Positives = 28/61 (45%) Query: 264 DGEETVYCFKEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTP 323 DG + L+D + + P +K LAQ+ GL QV WF+NRR R + Sbjct: 78 DGSRKKLRLSKDQSAVLEDSFREHPTLNPRQKATLAQQLGLRPRQVEVWFQNRRARTKLK 137 Query: 324 Q 324 Q Sbjct: 138 Q 138 >03_06_0114 + 31751471-31751785,31751919-31752056,31752183-31752291, 31756033-31756598 Length = 375 Score = 37.9 bits (84), Expect = 0.013 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (8%) Query: 250 YRLRKKYPLPKTI-----WDGEETVYCFKEKSRNALKDCYYRNRYPTPDEKRALAQKTGL 304 + L K+P P +D ++C K +R +++ Y Y EK LAQ TGL Sbjct: 248 WELHYKWPYPSVRTHHIPFDQFNHIFCTK-LTRLKMREIY-GVVYEQEMEKMTLAQTTGL 305 Query: 305 TLTQVSNWFKNRRQRDRTP 323 Q++NWF N+R+R P Sbjct: 306 DQKQINNWFINQRKRHWKP 324 >03_05_0982 - 29394513-29394719,29395314-29395327,29395652-29395697, 29395798-29396040 Length = 169 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/30 (53%), Positives = 22/30 (73%) Query: 294 EKRALAQKTGLTLTQVSNWFKNRRQRDRTP 323 +K ALA+ TGL L Q++NWF N+R+R P Sbjct: 104 QKVALAESTGLDLKQINNWFINQRKRHWKP 133 >05_07_0112 - 27755604-27756449,27756624-27756887,27757428-27757532, 27757626-27758249,27759048-27759596,27759665-27760372, 27760449-27760658,27761266-27761421,27761524-27761664, 27762015-27762101,27762209-27762309,27763071-27763293, 27763384-27763548,27763621-27763713,27763801-27764292, 27764729-27764805,27765184-27765681,27765818-27766046 Length = 1855 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEM 331 L+ Y + YP + L+ K GLT Q+ WF +RR +DR P P R ++ Sbjct: 71 LERTYTEDPYPNETMRAELSVKLGLTDRQLQMWFCHRRLKDRKP-PPKRQQL 121 >02_05_0618 + 30400338-30400452,30400553-30400692,30400805-30401044, 30401157-30401693 Length = 343 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/33 (51%), Positives = 22/33 (66%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA+K GL QV+ WF+NRR R +T Q Sbjct: 101 PERKTELARKLGLQPRQVAVWFQNRRARWKTKQ 133 >02_05_0134 + 26161904-26162776 Length = 290 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 265 GEETVYCFKEKSRNALKDCYYRNRYPT-PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTP 323 G E F E+ +L+ ++ R P EK LA++ GL QV+ WF+N+R R R+ Sbjct: 61 GGERKRRFTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSK 120 Query: 324 Q 324 Q Sbjct: 121 Q 121 >02_01_0380 + 2757691-2758080,2758389-2758712 Length = 237 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/45 (40%), Positives = 26/45 (57%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 L+D + + + EK+ LA K GL+ QV WF+NRR R + Q Sbjct: 118 LEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRARTKLKQ 162 >10_08_0929 + 21633179-21633377,21633466-21633809,21633905-21634297 Length = 311 Score = 36.3 bits (80), Expect = 0.039 Identities = 19/53 (35%), Positives = 28/53 (52%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEML 332 L+D + + P +K ALA++ L QV WF+NRR R + Q E+L Sbjct: 169 LEDTFKEHNTLNPKQKAALARQLNLKPRQVEVWFQNRRARTKLKQTEVDCELL 221 >03_05_0985 - 29424698-29425183 Length = 161 Score = 36.3 bits (80), Expect = 0.039 Identities = 18/44 (40%), Positives = 27/44 (61%) Query: 282 DCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQ 325 + +YR P+ EK ALA+ TGL Q++N F N+R+R P + Sbjct: 65 ELHYRWPNPSEMEKIALAESTGLEQKQINNCFINQRKRHWKPTE 108 >02_04_0278 - 21507288-21507726,21507893-21507972,21508587-21508840, 21508988-21509180 Length = 321 Score = 36.3 bits (80), Expect = 0.039 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 KE+S + L+D + + TP +K LA + L QV WF+NRR R + Q Sbjct: 131 KEQS-SFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQ 181 >01_06_0968 + 33466574-33466607,33467087-33467115,33467438-33467595, 33468319-33468436,33468520-33468708,33469008-33469343, 33469468-33469569,33469696-33469890,33469993-33470155, 33470314-33470579,33470670-33470765,33470860-33471255, 33471403-33471501 Length = 726 Score = 35.9 bits (79), Expect = 0.052 Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 289 YPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRT 322 +P +KR L++ TGL L QV WF+N+R + +T Sbjct: 81 HPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVKT 114 >01_06_0212 + 27575406-27575604,27575723-27576241,27576371-27576387 Length = 244 Score = 35.9 bits (79), Expect = 0.052 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 4/90 (4%) Query: 265 GEETVYCFKEK--SRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRT 322 GE+TV + L+ Y +YP+ + L+ K GL+ Q+ WF +RR +DR Sbjct: 44 GEKTVKRMMKSPYQLEVLEKTYAVEQYPSETLRAELSAKIGLSDRQLQMWFCHRRLKDRK 103 Query: 323 P--QQPNRPEMLVPAQYAGPQGGLAQALLP 350 P ++ R E P L LP Sbjct: 104 PPTKRQRREEEAAAVPLMAPPPVLPPPALP 133 >09_03_0144 - 12728697-12729238,12729312-12729432 Length = 220 Score = 35.5 bits (78), Expect = 0.068 Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA++ G+ QV+ WF+NRR R +T Q Sbjct: 117 PERKSELARRLGIAPRQVAVWFQNRRARWKTKQ 149 >08_02_0670 - 19877091-19877618,19880033-19880436,19880505-19880622 Length = 349 Score = 35.5 bits (78), Expect = 0.068 Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA++ G+ QV+ WF+NRR R +T Q Sbjct: 110 PERKTELARRLGMAPRQVAVWFQNRRARWKTKQ 142 >07_03_1291 + 25545749-25546262,25546989-25547669,25547693-25547751, 25549152-25549242,25549330-25549743,25550191-25550243, 25550947-25551177,25551492-25551708,25551790-25551890, 25552446-25552532,25553536-25553676,25553839-25553961, 25554070-25554522,25554931-25555308,25555410-25556060, 25556264-25556368,25556482-25556707,25557204-25557241 Length = 1520 Score = 35.5 bits (78), Expect = 0.068 Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDR 321 L+ Y +YP ++ A GLT QV WFK RR+++R Sbjct: 443 LERFYSEVQYPQSEDIAEYATSVGLTYNQVRIWFKERRRKER 484 >06_01_0878 + 6735266-6735340,6735946-6736041,6738610-6738720, 6738816-6739309,6739422-6739587,6739666-6739789, 6739874-6739986,6740085-6740693,6743095-6743385, 6743845-6743913,6744099-6744188,6744281-6744696, 6744882-6744969 Length = 913 Score = 35.5 bits (78), Expect = 0.068 Identities = 17/42 (40%), Positives = 23/42 (54%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDR 321 LK + + YP+ K LAQ+ GLT QV+ WF + R R Sbjct: 718 LKAHFKEDPYPSRATKENLAQELGLTFNQVTKWFSSTRHYAR 759 >04_04_0667 + 27097741-27098085,27098203-27098547 Length = 229 Score = 35.5 bits (78), Expect = 0.068 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query: 272 FKEKSRNALKDCYYRNRYPT-PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 F E+ +L+ ++ + P EK LA++ GL QV+ WF+N+R R R+ Q Sbjct: 30 FTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQ 83 >03_01_0630 + 4635297-4636220 Length = 307 Score = 35.5 bits (78), Expect = 0.068 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 PD K +A+ GL QV+ WF+NRR R +T Q Sbjct: 66 PDRKARIARDLGLQPRQVAVWFQNRRARWKTKQ 98 >10_07_0134 + 13289641-13290216,13290435-13290914 Length = 351 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA+ GL QV+ WF+NRR R +T Q Sbjct: 128 PERKAQLARALGLQPRQVAIWFQNRRARWKTKQ 160 >09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 Length = 264 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA+ GL QV+ WF+NRR R +T Q Sbjct: 62 PERKARLARDLGLQPRQVAVWFQNRRARWKTKQ 94 >08_02_1031 - 23796755-23797171,23797243-23797595,23797676-23797715 Length = 269 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA+ GL QV+ WF+NRR R +T Q Sbjct: 67 PERKARLARDLGLQPRQVAVWFQNRRARWKTKQ 99 >03_02_0256 + 6899424-6899876,6900084-6900163,6900475-6900820 Length = 292 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 KE+S L+D + + P +K ALA++ L QV WF+NRR R + Q Sbjct: 133 KEQSA-LLEDRFREHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQ 183 >03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 Length = 390 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 292 PDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P+ K LA+ GL QV+ WF+NRR R +T Q Sbjct: 154 PERKMQLARALGLQPRQVAIWFQNRRARWKTKQ 186 >09_06_0034 + 20370672-20371109,20371120-20371515 Length = 277 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/53 (32%), Positives = 29/53 (54%) Query: 272 FKEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 F E+ +L+ + P +K LA++ GL QV+ WF+N+R R ++ Q Sbjct: 34 FSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQ 86 >09_04_0318 - 16620177-16620582,16620686-16620765,16620873-16621213, 16621298-16621559 Length = 362 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 KE+S L++ + + P +K ALA++ L QV WF+NRR R + Q Sbjct: 183 KEQSA-FLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQ 233 >01_06_0864 - 32546696-32546803,32546881-32546961,32547134-32547250, 32548264-32548338,32548618-32548680,32549122-32549187, 32549254-32549325,32549403-32549504,32549588-32549765, 32549871-32549926,32551578-32551688,32551797-32551865, 32551960-32552068,32552176-32552327,32552398-32552475, 32554257-32554379,32555527-32555646,32555729-32555809, 32555881-32556027,32556112-32556190,32557223-32557297, 32558004-32558113,32558984-32559082,32559700-32559815, 32559914-32560022,32560098-32560229,32560389-32560591, 32561428-32561585,32561668-32561797,32562529-32562607, 32562806-32562829 Length = 1073 Score = 33.9 bits (74), Expect = 0.21 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%) Query: 29 PFNYEPSQFYAQQELEKQYFSC--KKTKDERKTNAIYIDGKSYESQQRNKRYINFELKLP 86 P N S + +LE C K+ E+ + D S+ +N++ ++F L Sbjct: 720 PININDS--FLSSQLEDGDIICYQKRCSPEKLDHYRCADVPSFFEYIQNRQVVHFRLLEN 777 Query: 87 PHDDYFTIESDRQNYYDELKSCIHNESAL 115 P DD FT+E ++ YD++ + N+ L Sbjct: 778 PKDDDFTLELSKRFTYDDVVEKVANQLGL 806 >06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876, 4405985-4406128,4406224-4406375,4406453-4406552, 4406653-4406775,4406876-4407037,4407190-4407247, 4407324-4407502,4408294-4408402,4408567-4408637, 4408891-4408986,4409727-4409803,4410983-4411066, 4411473-4411607,4411744-4411819,4413072-4413167, 4413580-4413671,4413745-4413868,4413966-4414052 Length = 996 Score = 32.7 bits (71), Expect = 0.48 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query: 290 PTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPE 330 PTP KRA + T TQ K +RQR R QQP +P+ Sbjct: 84 PTPKRKRAAPSPSPKTPTQSEP--KRQRQRQRQRQQPKKPK 122 >11_06_0151 - 20643032-20643085,20643202-20643307,20643415-20643495, 20643588-20643715,20643829-20643903,20644853-20645374, 20646622-20646687,20647990-20648076,20648173-20648247, 20648705-20648821,20648932-20649015,20649152-20649217, 20649352-20649417,20650079-20650150,20650231-20650332, 20650428-20650605,20650700-20650755,20653159-20653269, 20653354-20653422,20653558-20653741,20653826-20653914, 20654070-20654147,20654509-20654631,20654755-20654874, 20654975-20655055,20655285-20655431,20655533-20655611, 20657114-20657223,20659138-20659236,20659467-20659582, 20659673-20659781,20659839-20660069,20660152-20660417, 20661349-20661506,20661601-20661751,20661897-20661966, 20662203-20662232 Length = 1451 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 59 TNAIYIDGKSYESQQRNKRYINFELKLPPHDDYFTIESDRQNYYDEL 105 T Y D SY N++ ++F L P DD F++E + + YD++ Sbjct: 789 TQMRYPDVPSYLEYVHNRQVVHFRLLEKPKDDDFSLELSKLHTYDDV 835 >10_08_1025 - 22391267-22391767,22392641-22392736,22392838-22393106, 22393257-22393431,22393503-22393718,22393819-22393926, 22394020-22394544,22394631-22394819,22394924-22395041, 22395172-22395437,22395521-22395658 Length = 866 Score = 32.3 bits (70), Expect = 0.64 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Query: 290 PTPDEKRAL--AQKTGLTLTQVSNWFKNRRQRDRTPQ 324 P PD+K+ L +Q+ GL QV WF+NRR + + Q Sbjct: 141 PHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMKAQQ 177 >08_02_1371 + 26493981-26494471,26497374-26497504,26497947-26498692 Length = 455 Score = 32.3 bits (70), Expect = 0.64 Identities = 34/137 (24%), Positives = 52/137 (37%), Gaps = 12/137 (8%) Query: 9 CSDRLSPPSDVTSGSETSLPPFNYEPSQFYAQQELEKQYFSCKKTKD-----ERKTNAIY 63 C P V SG E F + S+F+ QE ++ SC+K D RK Sbjct: 140 CEAHSKTPLVVVSGREMR---FCQQCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDP 196 Query: 64 IDGKSYESQQRNKRYINFELKLPPHDDYFTIESDRQNYYDELKSCIHNESALVELKGPTG 123 ++ SY + Q+ R+ F P I+++ YY + + S G T Sbjct: 197 MNSASYLASQQGARFSPFATPRPEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGST- 255 Query: 124 FEDAEGNERVQFCAENE 140 ++G R F E E Sbjct: 256 ---SDGGRRFPFLQEGE 269 >07_03_0126 - 13797395-13797451,13797590-13797707,13797802-13798004 Length = 125 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/42 (35%), Positives = 24/42 (57%) Query: 280 LKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDR 321 L+ + R Y +++ LA+K G+ QV WF+NRR R + Sbjct: 66 LESVFERCTYLGGNQRVQLAKKLGMEERQVKFWFQNRRTRKK 107 >02_05_0286 - 27506925-27507278,27508439-27508812,27509041-27509218, 27510878-27511105,27511215-27511316,27511415-27512131, 27512270-27512387,27512500-27512744,27512854-27513054, 27513920-27514324 Length = 973 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Query: 290 PTPDEKRA--LAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEML 332 P PDEK+ L+++ L QV WF+NRR + +T + + +L Sbjct: 290 PHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMKTQLERHENALL 334 >04_04_0841 - 28574497-28574883,28575815-28576188,28576262-28576439, 28576816-28576896,28578134-28578361,28578460-28578579, 28578646-28579353,28579471-28579588,28579686-28579978, 28580101-28580169 Length = 851 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Query: 290 PTPDEKRA--LAQKTGLTLTQVSNWFKNRR 317 P PDEK+ L+++ GL QV WF+NRR Sbjct: 127 PHPDEKQRAELSKRLGLEPRQVKFWFQNRR 156 >10_06_0180 + 11526139-11526172,11526365-11527218 Length = 295 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/46 (34%), Positives = 25/46 (54%) Query: 279 ALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 AL+ + + P+ K +A+ L QV+ WF+NRR R +T Q Sbjct: 66 ALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQ 111 >09_06_0020 - 20267190-20267612,20269086-20269495,20269573-20269747, 20270833-20271066,20271164-20271265,20271354-20272091, 20272204-20272321,20272417-20272667,20272768-20272932 Length = 871 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Query: 290 PTPDEKRA--LAQKTGLTLTQVSNWFKNRRQRDRT 322 P PDEK+ L+++ L QV WF+NRR + +T Sbjct: 145 PHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMKT 179 >08_01_0246 - 2028701-2029060,2029149-2030606,2030729-2031160 Length = 749 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Query: 290 PTPDEK--RALAQKTGLTLTQVSNWFKNRRQRDRTPQQ 325 P PD+K + L+++ GL QV WF+N+R + +T + Sbjct: 111 PHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHE 148 >06_03_0671 + 23348958-23349101,23349475-23349834,23350003-23350302, 23350399-23350488,23353290-23353766 Length = 456 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRD 320 K+ L+ Y R + PT ++ Q T L + WF++RR++D Sbjct: 250 KKVQLETLERVYSRTKRPTNTMISSIVQVTSLPRKTIVKWFEDRREQD 297 >06_03_1261 - 28814617-28814890,28814989-28815068,28815287-28815703 Length = 256 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 273 KEKSRNALKDCYYRNRYPTPDEKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 KE+S L+D + + + +K LA++ L QV WF+NRR R + Q Sbjct: 121 KEQS-TLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTKLKQ 171 >05_07_0225 + 28510996-28511080,28511184-28511437,28512964-28513085, 28513399-28513474,28513507-28513616,28513647-28513920 Length = 306 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Query: 294 EKRALAQKTGLTLTQVSNWFKNRR 317 +K+ LA + L ++QV WF+NRR Sbjct: 129 QKKELADRLNLRISQVDAWFRNRR 152 >08_02_0940 - 22822391-22822781,22822875-22823053,22823079-22823428, 22823522-22823765 Length = 387 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 294 EKRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 +K ALA++ L QV WF+NRR R + Q Sbjct: 233 QKVALAKQLNLRPRQVEVWFQNRRARTKLKQ 263 >01_06_1818 - 40093327-40093384,40093501-40093580,40093661-40093946, 40095007-40095291,40095386-40095513,40095625-40096560, 40096650-40096712,40096801-40096854,40096963-40097139, 40097452-40097583,40097666-40097785,40097935-40098627, 40098760-40099158,40099263-40099271 Length = 1139 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Query: 295 KRALAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 K+ LA+K + QV WF+NRR R + Q Sbjct: 1097 KQGLAEKLNIKPRQVEVWFQNRRARTKHKQ 1126 >03_02_0033 - 5148513-5148806,5148928-5149271,5149391-5149472 Length = 239 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 291 TPDEKRALAQKTGLTLTQVSNWFKNRRQRDRT 322 TP K LA + GL QV+ WF+NRR R ++ Sbjct: 85 TP-RKVQLAAELGLDAKQVAVWFQNRRARHKS 115 >06_03_0715 - 23823427-23823525,23823616-23823822,23823907-23824017, 23824124-23824322,23824410-23824495,23824940-23825098, 23825204-23825302,23825385-23826578,23826666-23826734, 23828042-23828812 Length = 997 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 82 ELKLPPHDDYFTIESDRQNYYDELKSC 108 ELKLPP+D YF + + D + SC Sbjct: 287 ELKLPPNDAYFKLRHTLEAINDLISSC 313 >06_01_0653 - 4720913-4721152,4721898-4721966,4722059-4722124, 4722814-4722879,4723001-4723162,4723255-4723347, 4723449-4723541,4723626-4724273 Length = 478 Score = 29.1 bits (62), Expect = 5.9 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 8/95 (8%) Query: 96 SDRQNYYDELKSCIHNESALVELKGPTGFEDAEGNERVQFCAENENNNT---RRCLNFNS 152 S+ N+ D E +L P+G+ G++R ENE N T CL +N+ Sbjct: 16 SENYNFVDGSSESYAEEGSLP----PSGYFMGAGSDRSLKITENERNPTMLANGCLPYNT 71 Query: 153 EQVQCVCEALQQKGDIEKLAAFLWSLPSSELLRGN 187 Q + + KG++ L L +S LR N Sbjct: 72 -QAHPLSGQILPKGELPNNLLDLQQLQNSSNLRSN 105 >04_04_1462 - 33769122-33769151,33769385-33769426,33769571-33770158, 33770398-33770508,33770585-33770625,33771238-33771382, 33771578-33771781,33772626-33772769,33772991-33773183, 33774559-33774602,33774694-33774822,33774907-33774954, 33775058-33775120,33775198-33775236,33776694-33776767, 33777460-33777518,33777709-33777768,33777920-33778044, 33778693-33778751,33779418-33779511,33779572-33779625, 33779775-33779813,33780423-33780602 Length = 854 Score = 29.1 bits (62), Expect = 5.9 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 1/97 (1%) Query: 27 LPPFNYEPSQFYAQQELEKQYFSCKKTKDERKTNAIYIDGKSYESQQRNKRYINFELKLP 86 LP E + + ++ + ++ K+ K+ RK +D K E+ + K Y + +K P Sbjct: 273 LPEDEKEKFKEFIKERVRERKRELKQAKEARKKAIDDMDPKVKEAFENIKFYKFYPVKTP 332 Query: 87 PHDDYFTIESDRQN-YYDELKSCIHNESALVELKGPT 122 D +++ N YY + ESA + G T Sbjct: 333 DTPDVSNVKAKYINRYYRHAHHLMGGESAAFLIVGST 369 >04_04_1231 - 31934745-31935125,31935230-31935325,31936215-31936277, 31936393-31936593,31936738-31936839,31936972-31937430, 31937524-31937712,31938325-31938442,31939033-31939307, 31939853-31939930 Length = 653 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 290 PTPDEK--RALAQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEML 332 P PD+K + L+++ GL QV WF+N+R + + + + L Sbjct: 124 PHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKNQHERHENSQL 168 >08_01_0574 + 5103466-5103534,5104526-5104806,5104959-5105127 Length = 172 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Query: 290 PTPDEK--RALAQKTGLTLTQVSNWFKNRR 317 P PD+K + L+++ GL QV WF+N+R Sbjct: 123 PHPDDKQRKELSRELGLEPLQVKFWFQNKR 152 >06_01_0741 - 5510159-5510581,5510862-5511124,5511223-5511400, 5511411-5511698,5511801-5511899,5511973-5512440, 5512559-5512744,5512887-5513004,5513035-5513228 Length = 738 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 290 PTPDE-KRA-LAQKTGLTLTQVSNWFKNRR 317 P PDE +RA L+++ GL Q+ WF+NRR Sbjct: 71 PHPDENQRAQLSRELGLEPRQIKFWFQNRR 100 >05_03_0501 + 14744913-14745107,14745545-14745571,14746002-14746097, 14746479-14746769 Length = 202 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 299 AQKTGLTLTQVSNWFKNRRQRDRTPQQPNRPEM 331 A + GLT Q+ WF +RR +DR P P R ++ Sbjct: 104 AGELGLTDKQLQMWFCHRRLKDRKP-PPKRQQL 135 >01_06_1142 + 34856497-34856698,34857852-34858402 Length = 250 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 298 LAQKTGLTLTQVSNWFKNRRQRDRTPQ 324 L+Q ++ T V NWF+NRR R + Q Sbjct: 126 LSQHGQISETNVYNWFQNRRARSKRKQ 152 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.132 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,675,954 Number of Sequences: 37544 Number of extensions: 504524 Number of successful extensions: 1258 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 1195 Number of HSP's gapped (non-prelim): 71 length of query: 368 length of database: 14,793,348 effective HSP length: 83 effective length of query: 285 effective length of database: 11,677,196 effective search space: 3328000860 effective search space used: 3328000860 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -