BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000090-TA|BGIBMGA000090-PA|IPR002000|Lysosome-associated membrane glycoprotein (Lamp)/CD68 (275 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64605-7|AAF98603.1| 296|Caenorhabditis elegans Lamp (lysosome-... 29 2.7 AC024788-4|ABE73331.1| 305|Caenorhabditis elegans Hypothetical ... 29 2.7 >U64605-7|AAF98603.1| 296|Caenorhabditis elegans Lamp (lysosome-associated membraneprotein) homolog protein 2 protein. Length = 296 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 174 VGKSYFCPDETVIELTEEDPSNPTLAHKAKLYLRQMRLQPFMFKRSGEFGPAWHC 228 VG SY+CP E + + D N A + + +Q FM + + FGP C Sbjct: 176 VGHSYYCPSEQKYAINDND--NDKYGPMAYIKFKLTTIQAFM-EDTDSFGPKETC 227 >AC024788-4|ABE73331.1| 305|Caenorhabditis elegans Hypothetical protein Y46E12A.4 protein. Length = 305 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Query: 15 SLQLDSQASTRRPRVTKYSKTTIAPGGSTESVTERSLVTATYRLQGGGGETCILLT 70 S++ ++ +ST+RP T S ++ ST S++ +L T + +GGG E +LLT Sbjct: 184 SIKSNATSSTKRPLSTTSSNSS---PDSTLSMSSENLGHTTKKGRGGGQEIGVLLT 236 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.319 0.132 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,079,302 Number of Sequences: 27539 Number of extensions: 236962 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 573 Number of HSP's gapped (non-prelim): 2 length of query: 275 length of database: 12,573,161 effective HSP length: 80 effective length of query: 195 effective length of database: 10,370,041 effective search space: 2022157995 effective search space used: 2022157995 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -