BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000090-TA|BGIBMGA000090-PA|IPR002000|Lysosome-associated membrane glycoprotein (Lamp)/CD68 (275 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 3.9 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.2 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.6 bits (46), Expect = 3.9 Identities = 13/57 (22%), Positives = 24/57 (42%) Query: 49 RSLVTATYRLQGGGGETCILLTVDALLDISYVTKLNERADANTFVPNNANVGGACKD 105 RS+ T + G E+ + + L D+S +L R + F+P + + D Sbjct: 42 RSVATQVFNRFGDDTESKLPVKAITLPDLSIPMQLGRRQPFSLFIPAHRKIAARLID 98 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 67 ILLTVDALLDISYVTKLNERADANTFVP 94 +L D +LD+ ++ + + D T VP Sbjct: 352 VLDEADRMLDMGFLPSIEKMVDHETMVP 379 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.132 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,652 Number of Sequences: 429 Number of extensions: 2544 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 275 length of database: 140,377 effective HSP length: 57 effective length of query: 218 effective length of database: 115,924 effective search space: 25271432 effective search space used: 25271432 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -