BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000088-TA|BGIBMGA000088-PA|IPR009617|Protein of unknown function DUF1226 (208 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0381 + 21657795-21658313 31 0.89 01_01_0853 + 6658237-6658531,6658683-6658823,6658969-6659238,665... 29 2.7 >01_05_0381 + 21657795-21658313 Length = 172 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 17 QVDLFTEFDDDPNQPVTDAYVELQSRYVQV 46 Q+DLF FD P +PVT E + R+ ++ Sbjct: 74 QIDLFMSFDPPPLEPVTGVSKEEEDRFAKI 103 >01_01_0853 + 6658237-6658531,6658683-6658823,6658969-6659238, 6659324-6659463,6659563-6659709,6660739-6661320 Length = 524 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 69 KFSALFDFDLSWKTHI-DVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIR 122 + A ++ ++K+ I D + AEL + K L +KW +LK ++++T R Sbjct: 329 EIQAPYNLRCAFKSEILDATKQAAELLRGLAKDLNNMKWSLQTSLLKHVHVSTER 383 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.138 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,795,189 Number of Sequences: 37544 Number of extensions: 223455 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 304 Number of HSP's gapped (non-prelim): 2 length of query: 208 length of database: 14,793,348 effective HSP length: 79 effective length of query: 129 effective length of database: 11,827,372 effective search space: 1525730988 effective search space used: 1525730988 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -