BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000088-TA|BGIBMGA000088-PA|IPR009617|Protein of unknown function DUF1226 (208 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 62 3e-10 SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) 44 7e-05 SB_5212| Best HMM Match : SH3_1 (HMM E-Value=4.9e-20) 44 7e-05 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12879| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 41 6e-04 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_55490| Best HMM Match : DUF1155 (HMM E-Value=7) 40 0.001 SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4688| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59719| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39046| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) 39 0.003 SB_18777| Best HMM Match : RhoGAP (HMM E-Value=4.9) 39 0.003 SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) 39 0.003 SB_11884| Best HMM Match : RhoGAP (HMM E-Value=7.4) 39 0.003 SB_3299| Best HMM Match : RhoGAP (HMM E-Value=2.2) 39 0.003 SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) 39 0.003 SB_53374| Best HMM Match : RhoGAP (HMM E-Value=1.2) 39 0.003 SB_36799| Best HMM Match : DUF74 (HMM E-Value=1.9) 39 0.003 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 39 0.003 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 39 0.003 SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7) 39 0.003 SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7) 39 0.003 SB_53124| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7) 39 0.003 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 38 0.005 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 38 0.006 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 38 0.006 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 38 0.006 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 38 0.006 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 38 0.006 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 38 0.006 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 38 0.006 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 38 0.006 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.006 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 38 0.006 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 38 0.008 SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_58009| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_17280| Best HMM Match : Ribosomal_S15 (HMM E-Value=6.2) 37 0.010 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 36 0.018 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 36 0.018 SB_32313| Best HMM Match : RnaseH (HMM E-Value=2.5) 36 0.018 SB_3627| Best HMM Match : DUF488 (HMM E-Value=8) 36 0.018 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 36 0.024 SB_50872| Best HMM Match : AraC_E_bind (HMM E-Value=7.5) 36 0.024 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 36 0.024 SB_15450| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_12578| Best HMM Match : DUF488 (HMM E-Value=9.4) 36 0.024 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) 36 0.024 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 36 0.024 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 36 0.024 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 36 0.024 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 36 0.024 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 36 0.024 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 36 0.024 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 36 0.032 SB_30951| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 36 0.032 SB_10577| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_54734| Best HMM Match : RVT_1 (HMM E-Value=0.24) 36 0.032 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 36 0.032 SB_41518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_35035| Best HMM Match : Mic1 (HMM E-Value=5.3) 36 0.032 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 35 0.042 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 35 0.042 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 35 0.042 SB_25962| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 35 0.042 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 35 0.042 SB_56622| Best HMM Match : ImpA-rel_N (HMM E-Value=1) 35 0.056 SB_54193| Best HMM Match : REF (HMM E-Value=8.4) 35 0.056 SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 35 0.056 SB_52991| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_42670| Best HMM Match : RVT_1 (HMM E-Value=5.6e-27) 35 0.056 SB_40188| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 35 0.056 SB_32784| Best HMM Match : RVT_1 (HMM E-Value=3.9e-26) 35 0.056 SB_30073| Best HMM Match : RVT_1 (HMM E-Value=3e-26) 35 0.056 SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_8667| Best HMM Match : SAP (HMM E-Value=2.3) 35 0.056 SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) 35 0.056 SB_567| Best HMM Match : RVT_1 (HMM E-Value=8.3e-05) 35 0.056 SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 35 0.056 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 35 0.056 SB_41512| Best HMM Match : SAP (HMM E-Value=2.3) 35 0.056 SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) 35 0.056 SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 34 0.074 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 34 0.074 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.074 SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.074 SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) 34 0.074 SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_57819| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_51255| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.074 SB_37579| Best HMM Match : SAP (HMM E-Value=2.3) 34 0.074 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 34 0.074 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 34 0.074 SB_26251| Best HMM Match : RVT_1 (HMM E-Value=0.0014) 34 0.074 SB_19206| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 34 0.074 SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) 34 0.074 SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) 34 0.074 SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.074 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.074 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.074 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 34 0.098 SB_51268| Best HMM Match : SAP (HMM E-Value=2.3) 34 0.098 SB_34517| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 34 0.098 SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) 34 0.098 SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.098 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 33 0.13 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 33 0.13 SB_25979| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 33 0.13 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 33 0.13 SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_11436| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) 33 0.17 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 33 0.17 SB_32160| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) 33 0.17 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) 33 0.23 SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) 33 0.23 SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 32 0.30 SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) 32 0.30 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 32 0.30 SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) 32 0.30 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 32 0.30 SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_55882| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_55514| Best HMM Match : RVT_1 (HMM E-Value=0.014) 32 0.39 SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) 32 0.39 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 32 0.39 SB_42988| Best HMM Match : Pox_D3 (HMM E-Value=2.2) 31 0.52 SB_39215| Best HMM Match : UME (HMM E-Value=4.4) 31 0.52 SB_37017| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_22599| Best HMM Match : UME (HMM E-Value=4.4) 31 0.52 SB_17170| Best HMM Match : RVT_1 (HMM E-Value=0.0023) 31 0.52 SB_16966| Best HMM Match : DUF598 (HMM E-Value=0.00017) 31 0.52 SB_13132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_11511| Best HMM Match : RVT_1 (HMM E-Value=0.79) 31 0.52 SB_1778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_27013| Best HMM Match : UME (HMM E-Value=4.4) 31 0.52 SB_20271| Best HMM Match : UME (HMM E-Value=8.1) 31 0.52 SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) 31 0.52 SB_37938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_1554| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_51458| Best HMM Match : CAMP_factor (HMM E-Value=7.4) 31 0.91 SB_35874| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 31 0.91 SB_9324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 30 1.6 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 30 1.6 SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) 30 1.6 SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 29 2.1 SB_47852| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 29 2.1 SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_55010| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 29 2.8 SB_25352| Best HMM Match : W2 (HMM E-Value=9.1e-20) 29 2.8 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_7300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 29 2.8 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_34669| Best HMM Match : DUF572 (HMM E-Value=1.6e-39) 29 2.8 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_9849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_3170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_54579| Best HMM Match : RVT_1 (HMM E-Value=2.7e-20) 29 3.7 SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_44307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_14263| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_53378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_43721| Best HMM Match : dsDNA_bind (HMM E-Value=7.7) 29 3.7 SB_38205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_15568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_13638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_9003| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_546| Best HMM Match : DUF683 (HMM E-Value=8.3) 29 3.7 SB_40787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 28 4.9 SB_3085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 28 4.9 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 28 4.9 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20) 28 6.4 SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_38097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_41082| Best HMM Match : RVT_1 (HMM E-Value=3.1e-24) 27 8.5 SB_6749| Best HMM Match : RVT_1 (HMM E-Value=0.069) 27 8.5 SB_56562| Best HMM Match : Lipase_GDSL (HMM E-Value=0.25) 27 8.5 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/69 (39%), Positives = 40/69 (57%) Query: 5 LMSDVVEEKQTIQVDLFTEFDDDPNQPVTDAYVELQSRYVQVYGGQLHIEAHFTGLRYLM 64 LM EEKQ + V LF + DD P + + +++++ Y L IEA FTGLR+++ Sbjct: 211 LMFGFSEEKQIVPVRLFENYVDDSYHPAVTININIAAKHIEFYSASLRIEAQFTGLRHIL 270 Query: 65 YNWPKFSAL 73 + WP SAL Sbjct: 271 FAWPATSAL 279 >SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) Length = 689 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Query: 71 SALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 S + DL+W H +VI K+A L++L+ L G L +Y A IRS +YGC+ Sbjct: 425 SVVISHDLTWDAHCEVIIKKANKRLHVLRQLKKSSLGESD--LVNVYCALIRSIVEYGCV 482 >SB_5212| Best HMM Match : SH3_1 (HMM E-Value=4.9e-20) Length = 300 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Query: 71 SALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 S + DL+W H +VI K+A L++L+ L G L +Y A IRS +YGC+ Sbjct: 59 SVVISHDLTWDAHCEVIIKKANKRLHVLRQLKKSSLGESD--LVNVYCALIRSIVEYGCV 116 >SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKW-GADPKVLKTIYIATIRSHFDYGCI 130 DL+W H +VI K+A L L+ VK G L +Y A IRS F+YGC+ Sbjct: 1319 DLTWDAHCEVIIKKANKRLYALRQQRKVKKSGLGESDLVDVYCALIRSIFEYGCV 1373 >SB_12879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC-ISTNL 134 DL+W H +VI K+A L L+ L K G L +Y A IRS +YGC S+NL Sbjct: 669 DLTWDAHCEVIIKKANKRLYALRQLK--KSGLGESDLVDVYCALIRSIVEYGCFFSSNL 725 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 41.1 bits (92), Expect = 6e-04 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L KWG D L T+Y + IRS +Y Sbjct: 23 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KWGLDAIELITVYRSLIRSVIEY 75 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y I+ N Sbjct: 142 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATIAWN 195 >SB_55490| Best HMM Match : DUF1155 (HMM E-Value=7) Length = 199 Score = 39.9 bits (89), Expect = 0.001 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL W+ H DVI K A L LK L K G L +Y + IRS +Y C+ Sbjct: 65 DLKWEAHCDVIVKNANKRLYTLKQLK--KSGVSHNDLVGVYCSLIRSIVEYSCV 116 >SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL W+ + DVI K+A L L+ L K G L +Y + IRS +YGC+ Sbjct: 595 DLKWEAYCDVIVKKANKRLYALRQLK--KSGVSNNDLVGVYCSLIRSIVEYGCV 646 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL W+ + DVI K+A L L+ L K G L +Y + IRS +YGC+ Sbjct: 1511 DLKWEAYCDVIVKKANKRLYALRQLK--KSGVSNNDLVGVYCSLIRSIVEYGCV 1562 >SB_4688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTNLF 135 DL+W H +VI +A L L+ L K G L +Y A IRS +YGC+ + ++ Sbjct: 73 DLTWDAHCEVIINKANKRLYALRQLK--KSGLGESDLVDVYCALIRSIVEYGCVFSLIY 129 >SB_59719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 49 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 100 >SB_39046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 39 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 90 >SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) Length = 390 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 227 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 278 >SB_18777| Best HMM Match : RhoGAP (HMM E-Value=4.9) Length = 260 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 97 DLSWSSHCDYVIKKSNRHLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 148 >SB_14210| Best HMM Match : RVT_1 (HMM E-Value=0.2) Length = 712 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 549 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 600 >SB_11884| Best HMM Match : RhoGAP (HMM E-Value=7.4) Length = 248 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 85 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 136 >SB_3299| Best HMM Match : RhoGAP (HMM E-Value=2.2) Length = 248 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 85 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 136 >SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) Length = 387 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 224 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 275 >SB_53374| Best HMM Match : RhoGAP (HMM E-Value=1.2) Length = 248 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 85 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 136 >SB_36799| Best HMM Match : DUF74 (HMM E-Value=1.9) Length = 251 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 97 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 148 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H+D + KRA L L+ L + G P + +Y + IRS +Y + Sbjct: 391 DLSWGAHVDYVLKRANRSLYALRQLK--RCGVSPVDIVLVYCSLIRSVIEYASV 442 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 1000 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSQRDLVSVYCSLIRSILEYACV 1051 >SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 581 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 632 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H+D + KRA L L+ L + G P + +Y + IRS +Y + Sbjct: 326 DLSWGAHVDYVLKRANRSLYALRQLK--RCGVSPVDIVLVYCSLIRSVIEYASV 377 >SB_267| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 284 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 121 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 172 >SB_58643| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 295 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 132 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVPERDLVSVYCSLIRSILEYACV 183 >SB_53124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K+ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 85 DLSWSSHCDYVIKKTNRRLYALRKLKSC--GVSERDLVSVYCSLIRSILEYACV 136 >SB_21912| Best HMM Match : RhoGAP (HMM E-Value=3.7) Length = 238 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + IRS +Y C+ Sbjct: 132 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVPERDLVSVYCSLIRSILEYACV 183 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H+D + KRA L L+ L + G P + +Y + IRS +Y + Sbjct: 673 DLSWGAHVDYVLKRANRRLYALRQLK--RCGVSPVDIVLVYCSLIRSVIEYASV 724 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K A L L+ L K G D K L T+Y + IRS +Y Sbjct: 45 LISCDLTWVAHCDFIIKNANKRLYALRVLK--KCGLDAKELITVYRSLIRSVIEY 97 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 226 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 279 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 226 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 279 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 190 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 243 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 142 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 195 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 540 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 593 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 226 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 279 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 782 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 835 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 80 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 133 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 670 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 723 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 175 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 228 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 850 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 903 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 640 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 693 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTN 133 +LSW H D ICK+A L +LK + G P+V + Y +R +Y + N Sbjct: 168 NLSWNEHCDNICKKANSTLGLLKRILS---GCSPEVKDSAYRTLVRPKLEYATSAWN 221 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCIS 131 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y I+ Sbjct: 93 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSPIRSVIEYASIA 149 >SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID CK+A G+ ++ L K + L+T+Y A ++ +FDY Sbjct: 96 DDKLNWGNHIDKFCKKAGPGIGAIRRL---KPFVPRESLETMYKALVQPYFDY 145 >SB_58009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 37.1 bits (82), Expect = 0.010 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Query: 70 FSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 F DL W H+D I K+A L L++L K G P L IY + IR +Y Sbjct: 60 FGVHISSDLKWNVHVDFIIKKANKRLYALRTLK--KPGVQPNDLVRIYCSLIRCVLEY 115 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 37.1 bits (82), Expect = 0.010 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID CK+A G+ ++ L K + L+T+Y A ++ +FDY Sbjct: 191 DDKLNWGNHIDKFCKKAGPGIGAIRRL---KPFVPRESLETMYKALVQPYFDY 240 >SB_17280| Best HMM Match : Ribosomal_S15 (HMM E-Value=6.2) Length = 315 Score = 37.1 bits (82), Expect = 0.010 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 4/91 (4%) Query: 38 ELQSRYVQVYGGQLHIEAHFTGLRYLMYNWPKFSAL-FDFDLSWKTHIDVICKRAELGLN 96 EL ++Q Y L E + +GL + K + DL+W H++ + K+A L Sbjct: 119 ELSVSFLQ-YQPSLPGELYISGLPIKRVDSYKILGVHLSSDLTWSVHVEYVIKKASKWLY 177 Query: 97 ILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L+SL K+G L IY IRS +Y Sbjct: 178 ALRSLK--KFGVQSNDLVRIYCVLIRSVLEY 206 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 36.3 bits (80), Expect = 0.018 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H D I K+A L L++L K G + + T+Y + IRS +Y + Sbjct: 756 DLSWGVHCDYIIKKANRRLYALRTLK--KCGVPVEDMVTVYCSLIRSVTEYASV 807 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 36.3 bits (80), Expect = 0.018 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC 129 DLSW H+D + K+A L+ L K G + L IY IRS +Y C Sbjct: 879 DLSWNKHVDYVVKKANKRFYALRLLK--KSGIPVQDLVAIYCVLIRSVVEYAC 929 >SB_32313| Best HMM Match : RnaseH (HMM E-Value=2.5) Length = 721 Score = 36.3 bits (80), Expect = 0.018 Identities = 28/87 (32%), Positives = 40/87 (45%), Gaps = 5/87 (5%) Query: 70 FSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-G 128 F DLSW H+D + K+A L L+ L K G + L IY IRS +Y G Sbjct: 565 FGVHISSDLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAG 622 Query: 129 CISTNL--FFITLVFALSWYHLQEGLP 153 + N+ F + +V + L+ LP Sbjct: 623 PVWANIPGFLVDIVEGIQKRALRIVLP 649 >SB_3627| Best HMM Match : DUF488 (HMM E-Value=8) Length = 188 Score = 36.3 bits (80), Expect = 0.018 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 31 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVLEYAGPVWANIT 88 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 89 GFLVDIVEGIQKRALRIVLP 108 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 536 LISCDLTWVAHCDFIIKKANKKLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 588 >SB_50872| Best HMM Match : AraC_E_bind (HMM E-Value=7.5) Length = 206 Score = 35.9 bits (79), Expect = 0.024 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 49 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAGPVWANIP 106 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 107 GFLVDIVEGIQKRALRIVLP 126 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 20 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 72 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 343 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 395 >SB_15450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.9 bits (79), Expect = 0.024 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 49 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAGPVWANIT 106 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 107 GFLVDIVEGIQKRALRIVLP 126 >SB_12578| Best HMM Match : DUF488 (HMM E-Value=9.4) Length = 249 Score = 35.9 bits (79), Expect = 0.024 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 92 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAGPVWANIT 149 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 150 GFLVDIVEGIQKRALRIVLP 169 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 60 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 112 >SB_6318| Best HMM Match : RVT_1 (HMM E-Value=0.72) Length = 485 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 414 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 466 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 619 LISCDLTWVAHCDFIIKKANKRLYALRILK--KCGLDAIELITVYRSLIRSVIEY 671 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 160 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 212 >SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 710 Score = 35.9 bits (79), Expect = 0.024 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 606 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAGPVWANIT 663 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 664 GFLVDIVEGIQKRALRIVLP 683 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 88 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 140 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 234 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 286 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 35.9 bits (79), Expect = 0.024 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ + A+ L +IY A I+ H +Y Sbjct: 684 DEHLNWDQHIDSLAKKVSSGIGAMKRISEI---ANQNTLVSIYNAIIQPHLNY 733 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 1008 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 1060 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 942 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 994 >SB_1670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.024 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 60 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 112 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 49 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 101 Score = 31.9 bits (69), Expect = 0.39 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + + +R H +Y CI Sbjct: 227 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLNCTLVRPHLEYASCI 279 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 691 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 743 >SB_30951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 49 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVVEYAGPVWANIT 106 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 107 GFLVDIVEGIQKRALRIVLP 126 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 74 FDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC 129 F DL W H+D + K+ L L+ L + PK L Y+ IR +Y C Sbjct: 641 FSSDLKWNAHVDEVIKKVNKRLYFLRQLK--RAHVKPKELILFYLTCIRPCTEYAC 694 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 35.5 bits (78), Expect = 0.032 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 45 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDVIELITVYRSLIRSVIEY 97 >SB_10577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 21 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVVEYAGPVWANIT 78 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 79 GFLVDIVEGIQKRALRIVLP 98 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 35.5 bits (78), Expect = 0.032 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 140 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSFIRSVIEY 192 >SB_54734| Best HMM Match : RVT_1 (HMM E-Value=0.24) Length = 299 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 183 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVVEYAGPVWANIT 240 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 241 GFLVDIVEGIQKRALRIVLP 260 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 842 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 894 >SB_41518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 94 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVVEYAGPVWANIT 151 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 152 GFLVDIVEGIQKRALRIVLP 171 >SB_35035| Best HMM Match : Mic1 (HMM E-Value=5.3) Length = 235 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 78 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVVEYAGPVWANIT 135 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 136 GFLVDIVEGIQKRALRIVLP 155 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 1735 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 1787 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 97 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 149 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 518 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTLVRPHLEYASCI 570 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L ++K + DP + +Y +R H +Y CI Sbjct: 102 DLSWGPHIEPMCAKANRVLGLVKRVCSDI--LDPTTRQLLYCTFVRPHLEYASCI 154 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 35.1 bits (77), Expect = 0.042 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 1002 DLSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRPVLEY 1050 >SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) Length = 272 Score = 35.1 bits (77), Expect = 0.042 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 212 DLSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRPVLEY 260 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 35.1 bits (77), Expect = 0.042 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 155 KFLGVFISHDLSWNNHVEHVLSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 212 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.1 bits (77), Expect = 0.042 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 27 DLAWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 75 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 35.1 bits (77), Expect = 0.042 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 375 KFLGVFISHDLSWNNHVEHVLSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 432 >SB_25962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 35.1 bits (77), Expect = 0.042 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K A L L+ L K G D L T+Y + IRS +Y Sbjct: 166 LISCDLTWVAHCDFIIKNANKRLYALRVLK--KCGLDAIELITVYPSLIRSLIEY 218 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 35.1 bits (77), Expect = 0.042 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DL+W H D I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 27 DLAWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 75 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 35.1 bits (77), Expect = 0.042 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 117 KFLGVFISHDLSWNNHVEHVLSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 174 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 35.1 bits (77), Expect = 0.042 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 74 FDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC 129 F DL W H+D + K+ L L+ L + PK L Y+ IR +Y C Sbjct: 648 FTSDLKWNVHVDEVIKKVNKRLYFLRQLK--RAHVKPKELILFYLTCIRPCTEYAC 701 >SB_56622| Best HMM Match : ImpA-rel_N (HMM E-Value=1) Length = 529 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 151 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 199 >SB_54193| Best HMM Match : REF (HMM E-Value=8.4) Length = 172 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 49 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 97 >SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 322 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 155 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 212 >SB_52991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 820 Score = 34.7 bits (76), Expect = 0.056 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Query: 64 MYNWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 ++++ L DL+W H D I K A L L+ L K G D L T+Y + IRS Sbjct: 442 VHSFKLLGGLISCDLTWVAHCDFIIKNANKRLYALRVLK--KCGLDAIELITVYQSLIRS 499 Query: 124 HFDY 127 +Y Sbjct: 500 LNEY 503 >SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 284 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 341 >SB_42670| Best HMM Match : RVT_1 (HMM E-Value=5.6e-27) Length = 591 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 435 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 483 >SB_40188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 34.7 bits (76), Expect = 0.056 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IRS +Y G + N+ Sbjct: 75 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLIAIYCVLIRSVGEYAGPVWANIT 132 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 133 GFLVDIVEGIQKRALRIVLP 152 >SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 329 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D + K+A L L+ L K G + L IY IRS +Y Sbjct: 279 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEY 327 >SB_32784| Best HMM Match : RVT_1 (HMM E-Value=3.9e-26) Length = 759 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 417 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 465 >SB_30073| Best HMM Match : RVT_1 (HMM E-Value=3e-26) Length = 416 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 330 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 378 >SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 117 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 174 >SB_8667| Best HMM Match : SAP (HMM E-Value=2.3) Length = 439 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 131 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 179 >SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) Length = 845 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 666 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 714 >SB_567| Best HMM Match : RVT_1 (HMM E-Value=8.3e-05) Length = 371 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 215 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 263 >SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 371 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 155 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 212 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 34.7 bits (76), Expect = 0.056 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DLSW H++ + +A L L+ L K G L TIY A IRS +Y Sbjct: 356 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALIRSVLEY 413 >SB_41512| Best HMM Match : SAP (HMM E-Value=2.3) Length = 249 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 93 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 141 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 694 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 742 >SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) Length = 1788 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 359 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 407 >SB_534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 948 Score = 34.7 bits (76), Expect = 0.056 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 340 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 388 >SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 347 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_35509| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 256 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 65 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 114 >SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) Length = 347 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 439 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 488 >SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 265 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 314 >SB_22717| Best HMM Match : RuvA_C (HMM E-Value=7) Length = 256 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 65 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 114 >SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 323 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 132 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 181 >SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 683 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 732 >SB_57819| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 207 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 16 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 65 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 34.3 bits (75), Expect = 0.074 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H D I K+A L L++L K G + + T+Y + IR +Y + Sbjct: 4132 DLSWGVHCDYIIKKANRQLYALRTLK--KCGVPVEDMVTVYCSLIRPITEYASV 4183 >SB_51255| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 211 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 16 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 65 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 749 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 798 >SB_37579| Best HMM Match : SAP (HMM E-Value=2.3) Length = 287 Score = 34.3 bits (75), Expect = 0.074 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 131 DLSWNVHVDHIVKKASKRLFALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 179 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 226 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 275 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 184 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 233 >SB_26251| Best HMM Match : RVT_1 (HMM E-Value=0.0014) Length = 391 Score = 34.3 bits (75), Expect = 0.074 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 279 DLSWNVHVDHIVKKASKRLYALRVLR--KAGIQQSDMVLIYCSLIRSVLEY 327 >SB_19206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 34.3 bits (75), Expect = 0.074 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL 134 DL W H+D + K+A L L+ L K G + L IY IRS +Y G + TN+ Sbjct: 21 DLLWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRSVVEYAGPVWTNI 77 >SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) Length = 717 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 629 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 678 >SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) Length = 759 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 575 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 624 >SB_7670| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 215 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 65 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 114 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 946 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 995 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 489 DEHLNWDQHIDSLAKKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 538 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 33.9 bits (74), Expect = 0.098 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DL+W+ H D I K+A L ++ L + GA + +Y + +RS +Y Sbjct: 209 KFLGVFITHDLTWEVHCDSIVKKANRRLYAIRQLK--RCGASTDDIIVVYRSLVRSTLEY 266 Query: 128 GCI 130 + Sbjct: 267 ASV 269 >SB_51268| Best HMM Match : SAP (HMM E-Value=2.3) Length = 204 Score = 33.9 bits (74), Expect = 0.098 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D + K+A L L+ L K G + IY + IRS +Y Sbjct: 93 DLSWNVHVDHLVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 141 >SB_34517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 33.9 bits (74), Expect = 0.098 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H+D I K+A L L+ L K G + IY IRS +Y Sbjct: 207 DLSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCLLIRSVLEY 255 >SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) Length = 692 Score = 33.9 bits (74), Expect = 0.098 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 533 DFSWNTHCDAIVKKATKRLYAIRALK--KCGLSSNDLIQVYCSTMRPVLEY 581 >SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) Length = 300 Score = 33.9 bits (74), Expect = 0.098 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L + K + DP + +Y +R H +Y CI Sbjct: 225 DLSWGPHIEPMCAKANRVLGLAKRVCSDI--LDPTSRQLLYCTLVRPHLEYASCI 277 >SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 33.9 bits (74), Expect = 0.098 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H D I K+A L L+ L K G D L T++ + IRS +Y Sbjct: 20 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIKLITVHRSLIRSVIEY 72 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 33.9 bits (74), Expect = 0.098 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 1630 DEHLNWDQHIDSLVKKVSSGIGAMKRISEF---ANQNALVSIYNAIIQPHLNY 1679 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 520 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNNLIQVYCSTMRPVLEY 568 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 400 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRPVLEY 448 >SB_25979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC-ISTNL 134 DL W +HID + K+A + ++ L + G + + +Y IRS +YG + +NL Sbjct: 39 DLKWTSHIDYVIKKANKRIYAIRILK--RSGVQVRDIVEVYCTLIRSILEYGAPVYSNL 95 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 268 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRPVLEY 316 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 77 DLSWK-THIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW H D I K+A L L++L K G K + T+Y + IRS +Y + Sbjct: 2729 DLSWGGVHCDYIIKKANRRLYALRTLK--KCGVPVKDMVTVYCSLIRSITEYASV 2781 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 151 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNNLIQVYCSTMRPVLEY 199 >SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1837 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 77 DLSWKTHID--VICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL W+ H VI K+A L L+ L K G L +Y + IRS +YGC+ Sbjct: 1677 DLKWEAHCVGIVIVKKANKRLYALRQLK--KSGVSHNDLVGVYCSLIRSTVEYGCV 1730 >SB_11436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 33.5 bits (73), Expect = 0.13 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 5/80 (6%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCISTNL- 134 DLSW H+D + K+A L L+ L K G + L IY IR +Y G + N+ Sbjct: 511 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRYVVEYAGPVWANIT 568 Query: 135 -FFITLVFALSWYHLQEGLP 153 F + +V + L+ LP Sbjct: 569 GFLVDIVEGIQKRALRIVLP 588 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A L +++L K G L +Y +T+R +Y Sbjct: 569 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRPVLEY 617 >SB_9025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 33.1 bits (72), Expect = 0.17 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + K+ G+ K ++ A+ L +IY A I+ H +Y Sbjct: 87 DEHLNWDQHIDSLAKKVSSGIGATKRISEF---ANQNTLVSIYNAIIQPHLNY 136 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L +LK + DP + +Y +R +Y CI Sbjct: 594 DLSWGPHIEPMCAKANRVLGLLKRVCSDI--LDPTTRQLLYCTLVRPSLEYASCI 646 >SB_48195| Best HMM Match : DUF229 (HMM E-Value=0) Length = 1743 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC-ISTNL 134 DL W +HID + K+A + ++ L + G + + +Y IRS +YG + +NL Sbjct: 1201 DLKWTSHIDYVIKKANKRIYAIRILK--RSGVHVRDIVEVYCTLIRSILEYGAPVYSNL 1257 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 33.1 bits (72), Expect = 0.17 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L DL+W H I K+A L L+ L K G D L T+Y + IRS +Y Sbjct: 405 LISCDLTWVAHCGFIIKKANKRLYALRVLK--KCGLDAIELITVYRSLIRSVIEY 457 >SB_32160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC-ISTNL 134 DL W +HID + K+A + ++ L + G + + +Y IRS +YG + +NL Sbjct: 188 DLKWTSHIDYVIKKANKRIYAIRILQ--RSGVHVRDIVEVYCTLIRSILEYGAPVYSNL 244 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY-GCI 130 DLSW HI+ +C +A L +LK + DP + +Y +R +Y CI Sbjct: 97 DLSWGPHIEPMCAKANRVLGLLKRVCSDI--LDPTTRQLLYCTLVRPSLEYASCI 149 >SB_6581| Best HMM Match : HEAT (HMM E-Value=3e-05) Length = 1188 Score = 33.1 bits (72), Expect = 0.17 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D +LSW+ HID K+ G+ L+ V+ TIY A I HFDY Sbjct: 1017 DKNLSWEKHIDEKSKKLSSGIGALER---VRPFVSRGTACTIYKALIEPHFDY 1066 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 32.7 bits (71), Expect = 0.23 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H + I K+A L L+ L K G + L T+Y + +RS +Y Sbjct: 4358 DLSWNLHCETIFKKAMKRLYGLRVLK--KSGLTSEDLATVYCSIVRSTLEY 4406 >SB_28392| Best HMM Match : Exo_endo_phos (HMM E-Value=0.77) Length = 549 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DL W H++ + K+A L L+SL K G L IY IR+ +Y Sbjct: 393 DLMWNMHVEYVIKKASKRLYALRSLK--KSGVQSNDLVCIYCVLIRAVLEY 441 >SB_18662| Best HMM Match : Toxin_27 (HMM E-Value=2) Length = 253 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/39 (35%), Positives = 21/39 (53%) Query: 63 LMYNWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSL 101 + +NW K D L++ THI+ IC+RA +L L Sbjct: 87 IKHNWRKQCVTIDDQLNFSTHINEICRRASQRAGVLMRL 125 >SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 951 Score = 32.7 bits (71), Expect = 0.23 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 DLSW H+D + K+A L L+ L K G + L IY IRS Sbjct: 904 DLSWNKHVDYVVKKANKRLYALRLLK--KSGVPVQDLVAIYCVLIRS 948 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DL+W+ H D I K+A L ++ L + G + +Y + +RS +Y Sbjct: 589 KFLGVFITHDLTWEVHCDSIVKKANRRLYAIRQLK--RCGVSTDDIIVVYRSLVRSTLEY 646 Query: 128 GCI 130 + Sbjct: 647 ASV 649 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DL+W+ H D I K+A L ++ L + G + +Y + +RS +Y Sbjct: 705 KFLGVFITHDLTWEVHCDSIVKKANRRLYAIRQLK--RCGVSTDDIIVVYRSLVRSTLEY 762 Query: 128 GCI 130 + Sbjct: 763 ASV 765 >SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 328 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + + G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLANKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DL+W+ H D I K+A L ++ L + G + +Y + +RS +Y Sbjct: 363 KFLGVFITHDLTWEVHCDSIVKKANRRLYAIRQLK--RCGVSTDNIIVVYRSLVRSTLEY 420 Query: 128 GCI 130 + Sbjct: 421 ASV 423 >SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 208 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + + G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLANKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 78 LSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 L+W HID + ++ G+ L+ + D L +I+ A IR HF+Y Sbjct: 168 LNWDHHIDNVAEKVSSGIGALRRILDF---VDRDTLLSIHNAIIRPHFNY 214 >SB_34939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H + I K+A L L+ L K G + L T+Y + IRS +Y Sbjct: 147 DLSWNLHCETIFKKAMKRLYGLRVLK--KSGLASEDLVTVYCSIIRSTLEY 195 >SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D L+W HID + + G+ +K ++ A+ L +IY A I+ H +Y Sbjct: 156 DEHLNWDQHIDSLANKVSSGIGAMKRISEF---ANQNTLVSIYNAIIQPHLNY 205 >SB_55882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 837 Score = 31.9 bits (69), Expect = 0.39 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H++ + K+A L L+ L K G L IY + +RS +Y Sbjct: 49 DLSWSKHVEYVIKKANKRLYSLRVLR--KAGVAQVELVQIYCSLVRSVMEY 97 >SB_55514| Best HMM Match : RVT_1 (HMM E-Value=0.014) Length = 684 Score = 31.9 bits (69), Expect = 0.39 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 D SW TH D I K+A L +++L K G L +Y +T+R+ Sbjct: 265 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRA 309 >SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) Length = 511 Score = 31.9 bits (69), Expect = 0.39 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 DL+W H D +CK++ L L+ L K G L +Y + IRS Sbjct: 448 DLTWDVHCDHVCKKSNRRLYALRLLK--KCGVKELDLVNVYCSVIRS 492 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 31.9 bits (69), Expect = 0.39 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 D SW TH D I K+A L +++L K G L +Y +T+R+ Sbjct: 237 DFSWNTHCDAIVKKATKRLYAIRALK--KSGLSSNDLIQVYCSTMRA 281 >SB_42988| Best HMM Match : Pox_D3 (HMM E-Value=2.2) Length = 336 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 97 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 148 >SB_39215| Best HMM Match : UME (HMM E-Value=4.4) Length = 158 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 65 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 116 >SB_37017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 14 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 65 >SB_22599| Best HMM Match : UME (HMM E-Value=4.4) Length = 199 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 97 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 148 >SB_17170| Best HMM Match : RVT_1 (HMM E-Value=0.0023) Length = 391 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 224 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 275 >SB_16966| Best HMM Match : DUF598 (HMM E-Value=0.00017) Length = 377 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 195 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 246 >SB_13132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 146 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 197 >SB_11511| Best HMM Match : RVT_1 (HMM E-Value=0.79) Length = 289 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 187 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 238 >SB_1778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKT 115 DL+W H+D I K+A L L+SL K G P L + Sbjct: 286 DLTWNVHVDFIIKKANKSLYALRSLK--KAGVQPNDLNS 322 >SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 859 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 910 >SB_27013| Best HMM Match : UME (HMM E-Value=4.4) Length = 199 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 97 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 148 >SB_20271| Best HMM Match : UME (HMM E-Value=8.1) Length = 335 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 97 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 148 >SB_17450| Best HMM Match : RVT_1 (HMM E-Value=2.2e-25) Length = 472 Score = 31.5 bits (68), Expect = 0.52 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L +IY +RS +Y C+ Sbjct: 312 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSIYCCLVRSILEYACV 363 >SB_37938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.1 bits (67), Expect = 0.69 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 L DL+W H D I K+ L L+ L K G D L T+Y + IRS Sbjct: 70 LISCDLTWVAHCDFIIKKDNKRLYALRVLK--KCGLDAIELITVYRSLIRS 118 >SB_1554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 31.1 bits (67), Expect = 0.69 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 78 LSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +SW H+D I K+A L L+ L K G + IY + IRS +Y Sbjct: 18 VSWNVHVDHIVKKASKRLYALRVLR--KAGVQQSDMVLIYCSLIRSVLEY 65 >SB_51458| Best HMM Match : CAMP_factor (HMM E-Value=7.4) Length = 351 Score = 30.7 bits (66), Expect = 0.91 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC-ISTNL 134 DL W ++ID + K+A + ++ L + G + + +Y IRS +YG + +NL Sbjct: 189 DLKWTSYIDYVIKKANKRIYAIRILK--RSGVHVRDIVEVYCTLIRSILEYGAPVYSNL 245 >SB_35874| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) Length = 494 Score = 30.7 bits (66), Expect = 0.91 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DLSW +H D + K++ L L+ L G + L ++Y + I F G I Sbjct: 239 DLSWSSHCDYVIKKSNRRLYALRKLKSC--GVSERDLVSVYCSLISWSFRAGSI 290 >SB_9324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.7 bits (66), Expect = 0.91 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H + +A L L L G + KT+Y++ +RSH Y Sbjct: 53 DLSWGEHTHNVISKANKMLGFL--LRHCSNGLPLDLQKTLYVSLVRSHLTY 101 >SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 30.7 bits (66), Expect = 0.91 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 4/95 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCISTNLFF 136 DLSW H + +A + L+ G + KT+Y++ +RSH Y F Sbjct: 208 DLSWGEHTHNVISKANKMIGFLRQHCSN--GLPLDLQKTLYVSLVRSHLTYASQEIYKQF 265 Query: 137 ITLV-FALSW-YHLQEGLPEFIKSKLGTTPDKDED 169 L LS Y QEG + S T + ED Sbjct: 266 EKLYHHRLSQAYEAQEGDQSGMASSSDVTHTEHED 300 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H D + K+A L + L K G + Y A IRS +Y + Sbjct: 572 DLTWAAHCDYVVKKANRRLYAICQLK--KCGVPTSEIIKAYCALIRSSTEYASV 623 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +LSW H++ + K++ L L L + P L Y A IRS DY Sbjct: 565 NLSWNAHVNEVVKKSSKKLYFLIQLKRAR--LPPSDLSLFYKACIRSAVDY 613 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +LSW H++ + K++ L L L + P L Y A IRS DY Sbjct: 483 NLSWNAHVNEVVKKSSKKLYFLIQLKRAR--LPPSDLSLFYKACIRSAVDY 531 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATI 121 L DL+W H D I K+A L L+ L K G D L T+Y + I Sbjct: 273 LISCDLTWVAHCDFIIKKANKRLYALRVLK--KCGLDAIELITVYRSDI 319 >SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) Length = 379 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +LSW H++ + K++ L L L + P L Y A IRS DY Sbjct: 220 NLSWNAHVNEVVKKSSKKLYFLIQLKRAR--LPPSDLSLFYKACIRSAVDY 268 >SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1808 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DL W +HID + K+A + ++ L + G + + +Y IRS +Y Sbjct: 1646 DLKWTSHIDYVIKKANKIIYAIRILK--RSGVHVRDIVEVYCTLIRSILEY 1694 >SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) Length = 453 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 66 NWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHF 125 N D LSW HI I K+ G+ +K + L+ + A ++ HF Sbjct: 315 NTKSLGVCIDQHLSWNAHITNISKKIASGIGAIKRCRPF---VPLETLRYAFNAIVQPHF 371 Query: 126 DY 127 DY Sbjct: 372 DY 373 >SB_47852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 77 DLSWKTHIDVICKRAELGLNILKSL 101 DL+W H+D I K+A L L+SL Sbjct: 191 DLTWNVHVDFIIKKANKRLYALRSL 215 >SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) Length = 871 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 66 NWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHF 125 N D LSW HI I K+ G+ +K + L+ + A ++ HF Sbjct: 674 NTKSLGVCIDQHLSWNAHITNISKKIASGIGAIKRCRPF---VPLETLRYAFNAIVQPHF 730 Query: 126 DY 127 DY Sbjct: 731 DY 732 >SB_11192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +LSW H++ + K++ L L L + P L IY A IRS D+ Sbjct: 131 NLSWNAHVNEVVKKSSKKLYFLIQLKRAR--LPPSDLSLIYKACIRSAVDH 179 >SB_55010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 D LSWKTH+D + + L++L+ L + A V K + + + S +Y C+ Sbjct: 47 DQHLSWKTHVDSLLSSSYGTLSMLRRLKNL---APFHVRKHLVESLVLSKLNYACM 99 >SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLT-GVKWGADPKVLKTIYIATIRSHFDY 127 DLSW +D C +A L ++ + +K + +++Y+A +R H Y Sbjct: 157 DLSWTKQVDEACSKANRTLGFVRRHSRSIK---KTNIRRSMYLALVRPHLGY 205 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLT-GVKWGADPKVLKTIYIATIRSHFDY 127 DLSW +D C +A L ++ + +K + +++Y+A +R H Y Sbjct: 1190 DLSWTKQVDEACSKANRTLGFVRRHSRSIK---KTNIRRSMYLALVRPHLGY 1238 >SB_25352| Best HMM Match : W2 (HMM E-Value=9.1e-20) Length = 457 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 DLSW H + I K+A L L+ L K G + L T+Y + +RS Sbjct: 411 DLSWNLHCETIFKKAMKRLYGLRVLK--KSGLASEGLVTVYCSIVRS 455 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Query: 77 DLSWKTHIDVI---CKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC 129 DL W HID I CK+ GL LK + G VL + + +R +Y C Sbjct: 645 DLKWNDHIDDIITKCKKRMFGLRQLK-----RSGLGKSVLVSFFRTCVRPITEYAC 695 >SB_7300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 DL+W H + + K+A L ++ L K L + Y +RS +Y C+ Sbjct: 9 DLTWAAHCEYVVKKANRRLYAIRQLK--KSRVPQGDLVSSYCCLVRSILEYACV 60 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Query: 77 DLSWKTHIDVICKRAELGLNILKSL--TGVKWGADPKVLKTIYIATIRSHFDYGC 129 D SW H D + +A L L+ L +GV AD ++++ +Y IR +Y C Sbjct: 791 DFSWGPHCDYVIAKANRRLYALRKLKRSGV---ADSEIMQ-VYCRLIRPIMEYAC 841 >SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSL 101 D+ L++ THI+ ICKRA +L L Sbjct: 360 DYQLNFSTHINEICKRASQRAGVLMRL 386 >SB_34669| Best HMM Match : DUF572 (HMM E-Value=1.6e-39) Length = 593 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 77 DLSWKTHIDVICKRAELGLNILKSL 101 DLSW TH D I K+A L +++L Sbjct: 94 DLSWNTHCDAIVKKATKRLYAIRAL 118 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLT-GVKWGADPKVLKTIYIATIRSHFDY 127 DLSW +D C +A L ++ + +K + +++Y+A +R H Y Sbjct: 679 DLSWTKQVDEACSKANRTLGFVRRHSRSIK---KTNIRRSMYLALVRPHLGY 727 >SB_9849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 984 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLT-GVKWGADPKVLKTIYIATIRSHFDY 127 DLSW +D C +A L ++ + +K + +++Y+A +R H Y Sbjct: 911 DLSWTKQVDEACSKANRTLGFVRRHSRSIK---KTNIRRSMYLALVRPHLGY 959 >SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 66 NWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHF 125 N D LSW HI I K+ G+ +K + L+ + A ++ HF Sbjct: 356 NSKSLGVCIDQHLSWNAHITNISKKIASGIGAIKRCRPF---VPLETLRYAFNAIVQPHF 412 Query: 126 DY 127 DY Sbjct: 413 DY 414 >SB_3170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 DLSW H + I K+A L L+ L K + L +Y +T+RS +Y Sbjct: 119 DLSWNLHCETIFKKAMKSLYGLQVLK--KSSLAFEDLVAVYCSTVRSTLEY 167 >SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCIS 131 +FD L+W+ H++ +CK+ +++L+ + P Y A I S F Y C S Sbjct: 644 VFDNHLTWEPHVEHLCKKINSRISLLRRIAPF---LTPAGAIHYYNACIHSQFLY-CAS 698 >SB_54579| Best HMM Match : RVT_1 (HMM E-Value=2.7e-20) Length = 308 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATI 121 KF +F DLSW H++ + +A L L+ L K G L TIY A I Sbjct: 256 KFLGVFISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALI 307 >SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2033 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 66 NWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHF 125 N D LSW HI I K G+ +K + + L+ + A ++ HF Sbjct: 1130 NTKSLGVCVDQHLSWNAHITNISKNIASGIGAIKR---CRLFVPLETLRYAFNAIVQPHF 1186 Query: 126 DY 127 DY Sbjct: 1187 DY 1188 >SB_44307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 D LSWKTH+D + + L++L+ L + A V K + + + S +Y C+ Sbjct: 32 DQHLSWKTHVDSLLSSSYGTLSMLRRLKNL---APFHVRKHLAESLVLSKLNYACM 84 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRS 123 KF +F DL+W+ H D I K+A L ++ L + G + +Y + +RS Sbjct: 738 KFLGVFITHDLTWEVHCDSIVKKANRRLYAIRQLK--RCGVSTDNIIVVYRSLVRS 791 >SB_14263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 D LSWKTH+D + + L++L+ L + A V K + + + S +Y C+ Sbjct: 64 DQHLSWKTHVDSLLSSSYGTLSMLRRLKNL---APFHVRKHLAESLVLSKLNYACM 116 >SB_53378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIY 117 L DL+W H D I K A L L+ L K G D L T+Y Sbjct: 132 LISCDLTWVAHCDFIIKNANKRLYALRVLK--KCGLDAIELITVY 174 >SB_43721| Best HMM Match : dsDNA_bind (HMM E-Value=7.7) Length = 180 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Query: 6 MSDVVEEKQTIQVDLFTEFDDDPNQPVTDAY----VELQSRYVQVYGGQLHIEAHFTGLR 61 MSD+ + + T+QV+ + E +D P + + E+ S+Y +G + H+ H+ + Sbjct: 52 MSDLQQPRLTLQVNFYGEAAEDAGGPRREFFRLCLKEIMSKYFD-HGSRDHLTTHYLTVG 110 Query: 62 YLM 64 +M Sbjct: 111 IIM 113 >SB_38205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATI 121 DL W+ H DVI K+A L L+ L K G L +Y + Sbjct: 49 DLKWEAHCDVIVKKANKRLYALRQLK--KSGVSHNDLVGVYCCVV 91 >SB_15568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLT 102 DL+W H D +CK++ L L+ LT Sbjct: 97 DLTWDVHCDHVCKKSNRRLYALRLLT 122 >SB_13638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 D LSWKTH+D + + L++L+ L + A V K + + + S +Y C+ Sbjct: 35 DQHLSWKTHVDSLLSSSYGTLSMLRRLKNL---APFHVRKHLAESLVLSKLNYACM 87 >SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1125 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D LSW +HID I KR + L+ ++ L +IY + I FDY Sbjct: 72 DERLSWSSHIDNIAKRVSQAIGGLRQ---IRPYVPQNTLISIYKSLILQLFDY 121 >SB_9003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Query: 75 DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYG 128 D +LS+ H++ ICK+ + IL+ + A K IY A I+ F+YG Sbjct: 65 DSELSFDGHVEKICKKVASRIAILRKIRSFLPLAQ---RKQIYDALIQPIFNYG 115 >SB_546| Best HMM Match : DUF683 (HMM E-Value=8.3) Length = 160 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 66 NWPKFSALFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHF 125 N D LSW HI I K G+ +K + + L+ + A ++ HF Sbjct: 23 NTKSLGVCVDQHLSWNAHITNISKNIASGIGAIKR---CRLFVPLETLRYAFNAIVQPHF 79 Query: 126 DY 127 DY Sbjct: 80 DY 81 >SB_40787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/29 (27%), Positives = 20/29 (68%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSL 101 +FD L+W+ H++ +CK+ +++L+ + Sbjct: 85 VFDNHLTWEPHVEHLCKKINSRISLLRRI 113 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 KF +F DL+W+ H + I K+ L ++ L + G + +Y + +RS +Y Sbjct: 429 KFLGVFITHDLTWEVHCNSIVKKENRHLYAIRQLK--RCGVSTDNIIVVYRSLVRSTLEY 486 Query: 128 GCI 130 + Sbjct: 487 ASV 489 >SB_3085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/29 (27%), Positives = 20/29 (68%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSL 101 +FD L+W+ H++ +CK+ +++L+ + Sbjct: 85 VFDNHLTWEPHVEHLCKKINSRISLLRRI 113 >SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) Length = 951 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 68 PKFSALFDFDLSWKTHIDVICKRAELGLNILK 99 P F DL W +H+D I +A LN+++ Sbjct: 752 PYLGVQFSNDLKWNSHVDHITLKASRTLNLVR 783 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 77 DLSWKTHIDVICKRA-ELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 D SW TH D I K+A + L + +L K G L +Y +T+R +Y Sbjct: 275 DFSWNTHCDAIVKKATKRRLYAIGALK--KSGLSSNDLIQVYCSTMRPVLEY 324 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGC 129 DL+W HI I K+ L L+ L + K L Y+ IR +Y C Sbjct: 1188 DLTWNCHIAEILKKINKRLYFLRQLK--RANIKVKELLLFYLTCIRPVTEYAC 1238 >SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/29 (27%), Positives = 20/29 (68%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSL 101 +FD L+W+ H++ +CK+ +++L+ + Sbjct: 85 VFDNHLTWEPHVEHLCKKINSRISLLRRI 113 >SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/29 (27%), Positives = 20/29 (68%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSL 101 +FD L+W+ H++ +CK+ +++L+ + Sbjct: 186 VFDNHLTWEPHVEHLCKKINSRISLLRRI 214 >SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20) Length = 723 Score = 27.9 bits (59), Expect = 6.4 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIR 122 L DL+W H D I ++A L L+ L K G D T+Y + IR Sbjct: 676 LISCDLTWVAHCDFIIQKANKRLYALRVLK--KCGLDAIEQITVYRSLIR 723 >SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Query: 77 DLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDY 127 +L+W H+ + K+A L L L + G + L Y + +RS DY Sbjct: 872 NLTWNDHVTEVTKKASKRLYFLTQLK--RAGVPQQELVLFYTSCVRSLMDY 920 >SB_38097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 109 DPKVLKTIYIATIRSHFDYGCISTNLFFIT 138 DPK +Y A + HFDY C N +F T Sbjct: 265 DPKYRLYLYYA--KGHFDYHCAECNRYFRT 292 >SB_41082| Best HMM Match : RVT_1 (HMM E-Value=3.1e-24) Length = 308 Score = 27.5 bits (58), Expect = 8.5 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 69 KFSALF-DFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATI 121 KF ++ DLSW H++ + +A L L+ L K G L TIY A I Sbjct: 256 KFLGVYISHDLSWNNHVEHVFSKANKRLYALRLLK--KAGLSVHDLCTIYCALI 307 >SB_6749| Best HMM Match : RVT_1 (HMM E-Value=0.069) Length = 387 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 77 DLSWKTHIDVICKRAELGLNILKSL 101 D SW TH D I K+A L +++L Sbjct: 302 DFSWNTHCDAIVKKATKRLYAIRAL 326 >SB_56562| Best HMM Match : Lipase_GDSL (HMM E-Value=0.25) Length = 473 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 77 DLSWKTHIDVICKRAELGLNILKSL 101 DLSW H+D + K+A L L+ L Sbjct: 436 DLSWNKHVDYVVKKANKRLYALRLL 460 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.138 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,716,007 Number of Sequences: 59808 Number of extensions: 252900 Number of successful extensions: 847 Number of sequences better than 10.0: 249 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 167 Number of HSP's that attempted gapping in prelim test: 714 Number of HSP's gapped (non-prelim): 253 length of query: 208 length of database: 16,821,457 effective HSP length: 79 effective length of query: 129 effective length of database: 12,096,625 effective search space: 1560464625 effective search space used: 1560464625 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -