BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000088-TA|BGIBMGA000088-PA|IPR009617|Protein of unknown function DUF1226 (208 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 33 0.008 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.94 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 2.9 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 6.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.8 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 32.7 bits (71), Expect = 0.008 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLTGVKWGADPKVLKTIYIATIRSHFDYGCI 130 L D L++K HID + R L ++ T +P +K +Y +RS +Y C+ Sbjct: 850 LLDSSLNFKQHIDDVVARGNQLLGVVIRTTNEF--RNPMCIKAVYNCIVRSVLEYSCV 905 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.8 bits (54), Expect = 0.94 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Query: 78 LSWKTHIDVICKRAELGLNILKSLTGV-KWGADPKVLKTIYIATI 121 LSW+ H++++ +A L ++++L G+ + + P+V K +A + Sbjct: 751 LSWRPHVEMVADKA---LRVVRALRGIMRNHSGPQVSKRKLLAAV 792 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/30 (30%), Positives = 17/30 (56%) Query: 73 LFDFDLSWKTHIDVICKRAELGLNILKSLT 102 + D L +K+H++ CK+ +N L + T Sbjct: 772 VIDDRLKFKSHLEEACKKVMKAINALAAFT 801 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 6.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 107 GADPKVLKTIYIATIRSHFDY 127 G +PK+L+T T+R DY Sbjct: 714 GPEPKILETYSKLTMRDAMDY 734 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.8 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 5 LMSDVVEEKQTIQVD-LFTEFDDDPNQPVTDAY 36 L+ V T +D L+ E+DDDPN A+ Sbjct: 1989 LVDSGVAPNSTNFIDTLYGEYDDDPNLRYRSAF 2021 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 8.8 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Query: 8 DVVEEKQTIQVDLFTEFDDDPNQPVTDAYVELQSRYVQVYGGQLHIEAHFTGLRYLMYNW 67 D + Q + VD + +PN V D Y +S+Y Q+ ++ E F L+ Sbjct: 2068 DEKKHAQHVLVDYKSHQILNPNWYVRDLYFFKRSQYPQLRLVEMKPEESFNALQ-RQELC 2126 Query: 68 PKFSALFDFDLSWK--THIDVICKR 90 KF + L+W ++D++ +R Sbjct: 2127 KKFVEIGKVHLTWAILKNVDMVVQR 2151 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.138 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,649 Number of Sequences: 2123 Number of extensions: 7419 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 6 length of query: 208 length of database: 516,269 effective HSP length: 61 effective length of query: 147 effective length of database: 386,766 effective search space: 56854602 effective search space used: 56854602 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -