Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000088-TA|BGIBMGA000088-PA|IPR009617|Protein of unknown
function DUF1226
         (208 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   3.7  
EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.     22   4.8  

>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 12/40 (30%), Positives = 18/40 (45%)

Query: 8   DVVEEKQTIQVDLFTEFDDDPNQPVTDAYVELQSRYVQVY 47
           D +E    I   L  E +    Q   DA+ +LQ +Y + Y
Sbjct: 370 DTLENVLAIVDRLMDETNQLTLQETADAFKDLQDKYYEEY 409


>EF117814-1|ABO38437.1|  570|Apis mellifera cryptochrome 2 protein.
          Length = 570

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)

Query: 127 YGCISTNLFFITL 139
           +GC+ST LF+  L
Sbjct: 275 FGCLSTRLFYYQL 287


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.321    0.138    0.419 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 55,146
Number of Sequences: 429
Number of extensions: 1987
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 208
length of database: 140,377
effective HSP length: 55
effective length of query: 153
effective length of database: 116,782
effective search space: 17867646
effective search space used: 17867646
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)