BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000086-TA|BGIBMGA000086-PA|IPR002589|Appr-1-p processing (244 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 5.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.8 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 226 LPIDVEIYETLMQ 238 LPIDV++Y T Q Sbjct: 58 LPIDVDVYNTEQQ 70 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.8 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 179 IKSIAFPCISTGIYGFPNRLAAHIALRTARKFLETNTEMNRIIFCTFLPI-DVEIY 233 +KS+ T YG A H AL TA T +E + + F + P+ D +IY Sbjct: 750 VKSLRLEGDETPPYGMELTEAEHYALYTAMAPHATASEFDEMSF-YYSPVEDGKIY 804 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,410 Number of Sequences: 429 Number of extensions: 2638 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 244 length of database: 140,377 effective HSP length: 56 effective length of query: 188 effective length of database: 116,353 effective search space: 21874364 effective search space used: 21874364 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -