SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000086-TA|BGIBMGA000086-PA|IPR002589|Appr-1-p processing
         (244 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    22   5.9  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    21   7.8  

>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/13 (61%), Positives = 10/13 (76%)

Query: 226 LPIDVEIYETLMQ 238
           LPIDV++Y T  Q
Sbjct: 58  LPIDVDVYNTEQQ 70


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 179 IKSIAFPCISTGIYGFPNRLAAHIALRTARKFLETNTEMNRIIFCTFLPI-DVEIY 233
           +KS+      T  YG     A H AL TA     T +E + + F  + P+ D +IY
Sbjct: 750 VKSLRLEGDETPPYGMELTEAEHYALYTAMAPHATASEFDEMSF-YYSPVEDGKIY 804


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.135    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,410
Number of Sequences: 429
Number of extensions: 2638
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 2
length of query: 244
length of database: 140,377
effective HSP length: 56
effective length of query: 188
effective length of database: 116,353
effective search space: 21874364
effective search space used: 21874364
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -