BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000082-TA|BGIBMGA000082-PA|IPR004000|Actin/actin-like (388 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 116 3e-28 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 116 bits (279), Expect = 3e-28 Identities = 60/145 (41%), Positives = 86/145 (59%), Gaps = 12/145 (8%) Query: 230 EQRLALETTVLVEPYTLPDGRVIKVGGERFEAPEALFQPHLINVEGQGIAELVFNTIQAA 289 E A ++ L + Y LPDG+VI +G ERF PEALFQP + +E GI E +N+I Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 290 DIDMRNELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLRNECDKLSKFKIRVEDPPR 349 D+D+R +LY + VLSGG+TMYPG+ R+++EI L S KI++ PP Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPE 109 Query: 350 RKDMVFIGGAVLAEVCKNRDNFWLS 374 +K V+IGG++LA + W+S Sbjct: 110 KKYSVWIGGSILASL-STFQQMWIS 133 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.139 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,221 Number of Sequences: 429 Number of extensions: 4820 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 388 length of database: 140,377 effective HSP length: 59 effective length of query: 329 effective length of database: 115,066 effective search space: 37856714 effective search space used: 37856714 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -