BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000081-TA|BGIBMGA000081-PA|IPR003958|Transcription factor CBF/NF-Y/archaeal histone, IPR009072|Histone-fold (119 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. 24 1.6 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 21 8.8 >Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. Length = 91 Score = 23.8 bits (49), Expect = 1.6 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 32 EARTGLAKAASVFVLYVTSAATNIVKNKKRKALTGQDVIDAM 73 E R G+ K VF+ V A ++ KRK +T DV+ A+ Sbjct: 53 EERRGVLK---VFLENVIRDAVAYTEHAKRKTVTAMDVVYAL 91 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 21.4 bits (43), Expect = 8.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 18 IVKEALPSGVSISKEARTGLAKAASVFVLYVTSAATNI 55 +V +L +SI + R G + +F+LY+ T + Sbjct: 632 LVNGSLSPPISIRRSVRQGDPLSMHLFILYLHPLITRL 669 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.131 0.344 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,890 Number of Sequences: 2123 Number of extensions: 1887 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 119 length of database: 516,269 effective HSP length: 57 effective length of query: 62 effective length of database: 395,258 effective search space: 24505996 effective search space used: 24505996 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -