BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000081-TA|BGIBMGA000081-PA|IPR003958|Transcription factor CBF/NF-Y/archaeal histone, IPR009072|Histone-fold (119 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 25 0.23 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 2.9 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 25.0 bits (52), Expect = 0.23 Identities = 12/32 (37%), Positives = 18/32 (56%) Query: 43 VFVLYVTSAATNIVKNKKRKALTGQDVIDAMK 74 VF+ V A ++ KRK +T DV+ A+K Sbjct: 61 VFLENVIRDAVTYTEHTKRKTVTAMDVVYALK 92 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 2.9 Identities = 12/32 (37%), Positives = 14/32 (43%) Query: 48 VTSAATNIVKNKKRKALTGQDVIDAMKDIEFD 79 VTSAA N + VI K I+FD Sbjct: 18 VTSAAVNHQRKSANNLAHSMKVIYEWKHIDFD 49 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.131 0.344 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,583 Number of Sequences: 429 Number of extensions: 542 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 119 length of database: 140,377 effective HSP length: 51 effective length of query: 68 effective length of database: 118,498 effective search space: 8057864 effective search space used: 8057864 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.7 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -