BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000080-TA|BGIBMGA000080-PA|IPR000697|EVH1 (338 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1374 - 33028790-33028951,33029033-33029087,33029402-330294... 29 7.1 12_01_0909 - 8828921-8829004,8829204-8829249,8829798-8829919,883... 28 9.3 04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 28 9.3 >04_04_1374 - 33028790-33028951,33029033-33029087,33029402-33029466, 33029558-33029701,33029825-33029878,33029971-33030220, 33030340-33030446,33031206-33031216,33032682-33032796, 33032897-33033005,33033088-33033203,33033288-33033647 Length = 515 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 36 VVINCGIVRGLKYNQATATFHQWRDARHVYGLNFSCREDADSFARAMMHTL 86 + I CG V +Y + A H W++ +H Y L+ + D + +H L Sbjct: 262 ICIICGFVGCGRYEEGHAIRH-WKETQHCYSLDLETQRVWDYVGDSYVHRL 311 >12_01_0909 - 8828921-8829004,8829204-8829249,8829798-8829919, 8830013-8830078,8830520-8830771,8830859-8830939, 8831193-8831294,8831373-8831410,8831497-8831602, 8831694-8831816,8831918-8831994,8833095-8833240, 8833355-8833533 Length = 473 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/55 (23%), Positives = 28/55 (50%) Query: 2 VYDDGQKRWVPSGSSSGLSKVHIYHHTQHNTFRVVVINCGIVRGLKYNQATATFH 56 VY+ G + GS+ L K+H+ ++ V+ ++ GL Y++ T+ ++ Sbjct: 105 VYEHGPFNFESGGSAKSLPKLHLNPYSWSKVSSVIYLDSPAGVGLSYSKNTSDYN 159 >04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 Length = 760 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/35 (28%), Positives = 22/35 (62%) Query: 298 VNGGEGGCVTAAEWDAFKQEMMKEMRKELNIMKRE 332 + GGEGG +++ W + + + ++R EL++ +E Sbjct: 479 LGGGEGGSASSSRWPKTEVQALIQLRMELDMRYQE 513 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.130 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,710,657 Number of Sequences: 37544 Number of extensions: 194417 Number of successful extensions: 476 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 474 Number of HSP's gapped (non-prelim): 3 length of query: 338 length of database: 14,793,348 effective HSP length: 82 effective length of query: 256 effective length of database: 11,714,740 effective search space: 2998973440 effective search space used: 2998973440 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -