BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000080-TA|BGIBMGA000080-PA|IPR000697|EVH1 (338 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31600.3 68414.m03879 oxidoreductase, 2OG-Fe(II) oxygenase fa... 30 2.5 At1g31600.2 68414.m03877 oxidoreductase, 2OG-Fe(II) oxygenase fa... 30 2.5 At1g31600.1 68414.m03878 oxidoreductase, 2OG-Fe(II) oxygenase fa... 30 2.5 >At1g31600.3 68414.m03879 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 431 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 31 NTFRVVVINCGIVRGLKYNQATATFHQWRDARHVYGLNFSCREDADSFAR--AMMHTLEI 88 N+ + V NCG GL +N A F ++ + VY + S SFA + LE Sbjct: 107 NSSNLYVANCGPAVGLTHNAIAAVFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 166 Query: 89 LANKP 93 L+ +P Sbjct: 167 LSGRP 171 >At1g31600.2 68414.m03877 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 344 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 31 NTFRVVVINCGIVRGLKYNQATATFHQWRDARHVYGLNFSCREDADSFAR--AMMHTLEI 88 N+ + V NCG GL +N A F ++ + VY + S SFA + LE Sbjct: 22 NSSNLYVANCGPAVGLTHNAIAAVFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 81 Query: 89 LANKP 93 L+ +P Sbjct: 82 LSGRP 86 >At1g31600.1 68414.m03878 oxidoreductase, 2OG-Fe(II) oxygenase family protein contains Pfam profiles PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 431 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 31 NTFRVVVINCGIVRGLKYNQATATFHQWRDARHVYGLNFSCREDADSFAR--AMMHTLEI 88 N+ + V NCG GL +N A F ++ + VY + S SFA + LE Sbjct: 107 NSSNLYVANCGPAVGLTHNAIAAVFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEA 166 Query: 89 LANKP 93 L+ +P Sbjct: 167 LSGRP 171 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.130 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,343,865 Number of Sequences: 28952 Number of extensions: 154168 Number of successful extensions: 409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 406 Number of HSP's gapped (non-prelim): 3 length of query: 338 length of database: 12,070,560 effective HSP length: 81 effective length of query: 257 effective length of database: 9,725,448 effective search space: 2499440136 effective search space used: 2499440136 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -