BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000078-TA|BGIBMGA000078-PA|IPR012496|TMC (612 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 26 0.79 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 26 1.0 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 25 1.8 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 25 1.8 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 25 1.8 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 25 1.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 1.8 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 25 1.8 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 25 2.4 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 25 2.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 24 3.2 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 24 3.2 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 24 3.2 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 24 3.2 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 3.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 3.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 3.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 3.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 3.2 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 3.2 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 3.2 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 24 3.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 3.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 3.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 3.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 3.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 3.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 3.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 3.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 3.2 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 24 3.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 3.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 3.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 3.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 3.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 3.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 3.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 24 4.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 4.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 4.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 4.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 4.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 4.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 4.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 4.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 4.2 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 5.5 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 7.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 7.3 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 7.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 7.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 7.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 7.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 9.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 9.7 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 26.2 bits (55), Expect = 0.79 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ LYNE K + EER ++ SRSRE + Sbjct: 18 RYEKLYNE-KEKLLEERTSRKRYSRSRERE 46 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.8 bits (54), Expect = 1.0 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER E+ SRSRE + Sbjct: 251 RYEKLHNE-KEKLLEERTSRERYSRSRERE 279 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 360 KGCIEEERIKEEKQSRSRESQ 380 K C EEE++ EE+ SR R S+ Sbjct: 21 KLCNEEEKLLEERTSRKRYSR 41 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 360 KGCIEEERIKEEKQSRSRESQ 380 K C EEE++ EE+ SR R S+ Sbjct: 21 KLCNEEEKLLEERTSRKRYSR 41 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 360 KGCIEEERIKEEKQSRSRESQ 380 K C EEE++ EE+ SR R S+ Sbjct: 21 KLCNEEEKLLEERTSRKRYSR 41 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 1.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 360 KGCIEEERIKEEKQSRSRESQ 380 K C EEE++ EE+ SR R S+ Sbjct: 21 KLCNEEEKLLEERTSRKRYSR 41 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.0 bits (52), Expect = 1.8 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K +EE R ++ SRSRE + Sbjct: 251 RYEKLHNEKKKLLEE-RTSRKRYSRSRERE 279 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 214 LLTERVYECDETEANSTVCCSIAYFEKNTTNSNIFLDV 251 LLT+ V E D+ A++ A FE+NTT+ ++ +DV Sbjct: 540 LLTQ-VAELDQIYADTHAKLVQAAFEQNTTDQSMDIDV 576 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 17 RYEKLHNE-KEKLLEERTNRKRNSRSRERE 45 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.6 bits (51), Expect = 2.4 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 17 RYEKLHNE-KEKLLEERTNRKRNSRSRERE 45 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 268 YTDQIYTYYVNSLYHTKLFYNMP-MAYILVPI 298 Y I Y N+ Y+ KL+YN+ + I VP+ Sbjct: 89 YISNISNYNNNNNYNKKLYYNINYIEQIPVPV 120 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 240 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 268 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 256 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 284 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 268 YTDQIYTYYVNSLYHTKLFYNMP-MAYILVPI 298 Y I Y N+ Y+ KL+YN+ + I VP+ Sbjct: 327 YISNISNYNNNNNYNKKLYYNINYIEQIPVPV 358 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 RYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 46 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 240 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 268 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 240 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 268 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 279 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 240 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 268 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 4.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K + EER ++ SRSRE + Sbjct: 240 QYEKLHNE-KEKLLEERTSRKRYSRSRERE 268 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 5.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 RYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 18 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 46 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKFLEERTSHKRYSRSRERE 279 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 279 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 7.3 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 351 KHQALYNEIKGCIEEERIKEEKQSRSRESQ 380 +++ L+NE K EER ++ SRSRE + Sbjct: 251 QYEKLHNE-KEKFLEERTSRKRYSRSRERE 279 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 9.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 28 ELYPGGEQELFDNLQRADAAKLATLLPSKQARNTTTV 64 ++ P EQ+ R+ + L TLLP TT V Sbjct: 1828 DISPMSEQKSLPRRGRSSRSSLRTLLPPISVAETTFV 1864 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 9.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 28 ELYPGGEQELFDNLQRADAAKLATLLPSKQARNTTTV 64 ++ P EQ+ R+ + L TLLP TT V Sbjct: 1824 DISPMSEQKSLPRRGRSSRSSLRTLLPPISVAETTFV 1860 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.324 0.137 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,341 Number of Sequences: 429 Number of extensions: 6925 Number of successful extensions: 152 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 64 Number of HSP's that attempted gapping in prelim test: 126 Number of HSP's gapped (non-prelim): 130 length of query: 612 length of database: 140,377 effective HSP length: 62 effective length of query: 550 effective length of database: 113,779 effective search space: 62578450 effective search space used: 62578450 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -