BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000077-TA|BGIBMGA000077-PA|undefined (224 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 25 0.48 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 1.5 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 3.4 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 4.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.4 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 25.0 bits (52), Expect = 0.48 Identities = 14/41 (34%), Positives = 22/41 (53%) Query: 45 EELGSRQKRRRVEQIYQSLSSSPDEIKATTIASLRNTGNED 85 +E +R+ ++ +L S EIK T+ SLRNT E+ Sbjct: 56 DEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSLRNTQEEE 96 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 207 LLLISKWGFDG 217 L L+ KWGFDG Sbjct: 130 LNLVQKWGFDG 140 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 43 PFEELGSRQKRRRVEQIYQSLSSSPDEIKATT 74 PF+ L ++KRR E + SSS E T Sbjct: 323 PFKWLFKKKKRRNRESTTNTQSSSLSEFLTNT 354 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 154 YYKIKQEKTKCYPGKEDIIIT 174 YYK+ ++K + G + +I+T Sbjct: 169 YYKLTKKKLSVFFGNKPVILT 189 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 170 DIIITEEGAAIKMQALLNLTVSRLLDVITLDLDS 203 D+ + E GA KMQ L L + ++ ++ S Sbjct: 549 DLTVLESGAFCKMQPLRTLKIGVYRNIKNFNIPS 582 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.129 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,968 Number of Sequences: 317 Number of extensions: 1462 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 224 length of database: 114,650 effective HSP length: 55 effective length of query: 169 effective length of database: 97,215 effective search space: 16429335 effective search space used: 16429335 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -