BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000073-TA|BGIBMGA000073-PA|IPR004210|BESS motif (316 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0457 + 18076911-18077272,18077356-18077475,18077554-180777... 31 0.92 01_05_0502 + 22771428-22771466,22772327-22772430,22773043-227731... 31 1.2 10_08_0905 - 21469688-21469933,21470175-21470499,21470586-214708... 31 1.6 04_04_1060 - 30473509-30473619,30473815-30473850,30474063-304740... 31 1.6 09_02_0133 + 4707944-4708308,4708320-4708534,4708626-4708672,470... 30 2.8 01_06_0930 + 33134385-33138257 30 2.8 01_05_0799 + 25334460-25334994,25335060-25335236,25335325-253354... 30 2.8 10_08_0906 - 21472490-21472732,21472947-21473271,21473351-214735... 29 3.7 06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785... 29 3.7 05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263,245... 29 3.7 05_05_0348 + 24271764-24271898,24273055-24273144,24273205-242733... 29 4.9 03_06_0448 - 34005581-34005655,34005735-34005830,34006669-340076... 29 4.9 02_03_0026 - 14045653-14045874,14047023-14047215,14047518-140476... 29 4.9 09_04_0500 - 18120287-18122233 29 6.5 09_02_0163 - 5133805-5134252,5134353-5134460,5135693-5136012 28 8.5 09_01_0044 + 796237-796327,797025-797079,798129-798639 28 8.5 05_07_0139 - 27968816-27968890,27969065-27969456,27969558-279696... 28 8.5 01_06_0168 + 27165323-27165373,27166659-27167067,27167666-271677... 28 8.5 >10_08_0457 + 18076911-18077272,18077356-18077475,18077554-18077782, 18077993-18078652,18079224-18079425,18079521-18079611, 18079780-18079837 Length = 573 Score = 31.5 bits (68), Expect = 0.92 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 91 EVTDRPDTVDKCNQTVID-KNPSLEIKIDANSILPDDHFDDDKLFMNSLIPLFKKMSDDT 149 E D D D + T D +PS+ ID + P D +D N+L+ LF +M Sbjct: 77 EDEDETDDEDDSSSTSPDGSSPSVSESIDISGTSPKDRSNDLLEKHNNLLNLFNRMMSSI 136 Query: 150 RLL 152 RLL Sbjct: 137 RLL 139 >01_05_0502 + 22771428-22771466,22772327-22772430,22773043-22773129, 22773212-22773287,22773393-22773467,22773639-22773692, 22773745-22773918,22774002-22774061,22774135-22774251, 22774448-22774542,22774811-22775013,22775177-22775274, 22775451-22775587,22776154-22776219,22776300-22776465, 22776537-22776659,22776763-22776845,22776943-22777084, 22777334-22777363,22777587-22777657,22777742-22778333 Length = 863 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Query: 9 HEDLQTRKVSAGPVRSEQQKIS-VPQADVVSIEGATEQPRYSQDKYESFSEVSNSPQHAP 67 H D+ A +E +S P +D V E ++P S D S SEV P+ + Sbjct: 762 HLDVSNGDAEASTEAAEAAPVSSAPSSDEVQTERTADEPTGSSDSGNSVSEVLPDPEDSS 821 Query: 68 PEDVIPKIKTE--VIDKPLDLKTK 89 + + +E V ++ ++L TK Sbjct: 822 IDPANTAVSSEQTVDNEDVELPTK 845 >10_08_0905 - 21469688-21469933,21470175-21470499,21470586-21470833, 21471061-21471315 Length = 357 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Query: 65 HAPPEDVIPKIKTEVID---KPLDLKTKAEVTDRPDTVDKCNQTVI 107 H P++VI +K +++D +PLD TK E T P++++ Q+ + Sbjct: 89 HGVPDEVIANLKRDIVDFFSQPLD--TKKEYTQLPNSLEGYGQSFV 132 >04_04_1060 - 30473509-30473619,30473815-30473850,30474063-30474095, 30474246-30474335,30474466-30475215 Length = 339 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Query: 40 EGATEQPRYSQDKYESFSEVSNSPQHAPPEDVIPKIKTEV 79 +G+T S++ S+SE N P+ P D+I ++K V Sbjct: 83 QGSTATDNISRNAASSYSENDNRPRETPGRDLIARLKERV 122 >09_02_0133 + 4707944-4708308,4708320-4708534,4708626-4708672, 4708997-4709393,4710042-4710608,4710708-4710838, 4711274-4711747 Length = 731 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Query: 69 EDVIPKIKTEVIDKPLD-LKTKAEVTDRPDTVDKCNQTVIDKNPSLE-IKIDANSILPDD 126 E V P + E ++ + T+A ++ + D VDK N +ID+ P E I + +S+ D Sbjct: 641 EYVFPSLDDERNTTSVEYMSTRAILSTKNDFVDKLNTKMIDRFPGKEKIYLSFDSVDDDP 700 Query: 127 HFDDDKLFMNSLIP 140 F+N++ P Sbjct: 701 QNSYSLDFLNTITP 714 >01_06_0930 + 33134385-33138257 Length = 1290 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Query: 35 DVVSIEGATEQPRYSQDKYESFS--EVSNSPQHAPPEDVIPKIKTEVIDKPLDLKT 88 DVV +E + + KY +FS E+ N HA E+V KI + PL +T Sbjct: 347 DVVHLENMEDAEFLALFKYHAFSGTEIRNPQLHARLEEVAEKIAKRLGQSPLAART 402 >01_05_0799 + 25334460-25334994,25335060-25335236,25335325-25335447, 25335559-25335624,25335717-25336685,25336791-25336912, 25337156-25337549,25337888-25338009,25338253-25338646, 25338983-25339104,25339348-25339830,25340291-25340960, 25341713-25342224,25342484-25342540 Length = 1581 Score = 29.9 bits (64), Expect = 2.8 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Query: 69 EDVIPKIKTEVIDKPLD-LKTKAEVTDRPDTVDKCNQTVIDKNPSLEIKIDANSILPDDH 127 E V P + E ++ + T+A ++ + D VDK N +ID+ P E + + DD Sbjct: 1433 EYVFPSLDDERNTTSVEYMSTRAILSTKNDFVDKLNMKMIDRFPGKEKIYHSFDSIDDDT 1492 Query: 128 FDDDKL-FMNSLIP 140 + L F+N++ P Sbjct: 1493 QNSYPLDFLNTITP 1506 >10_08_0906 - 21472490-21472732,21472947-21473271,21473351-21473598, 21473823-21474071 Length = 354 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Query: 52 KYESFSEVSNSPQHAPPEDVIPKIKTEVID---KPLDLKTKAEVTDRPDTVDKCNQTVI 107 +Y F ++ N H P++VI +K +++D +PLD K E T P++++ Q ++ Sbjct: 77 QYWGFFQLIN---HGVPDEVIANLKRDIVDFFSQPLD--AKKEYTQLPNSLEGYGQALV 130 >06_03_0924 - 25976629-25976979,25977471-25978424,25978512-25978565, 25979135-25979254,25979357-25979532,25979624-25980107, 25980541-25980744,25981671-25981877,25982179-25982271, 25982433-25982621,25983364-25983423,25983591-25983927, 25984195-25984432,25984614-25984816,25985549-25986554, 25987125-25987290,25987715-25987824,25987944-25988195, 25988360-25988402,25988488-25988550,25989512-25989624, 25990787-25990838 Length = 1824 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/91 (21%), Positives = 42/91 (46%), Gaps = 5/91 (5%) Query: 46 PRYSQDKYESFSEVSNSPQHAPPEDVIPKIKTEVIDKPLDLKTKAEV--TDRPDTVDKCN 103 P+Y +D S +V++ H P D++ + + +K L K +E T+ P++++K Sbjct: 1401 PKYGEDPETSEMDVNSIRSH--PPDIVSNAQIKTSNKRLVAKVSSEAFETEGPESIEKAK 1458 Query: 104 QTVID-KNPSLEIKIDANSILPDDHFDDDKL 133 + K + E +D N + D ++ Sbjct: 1459 PVPVKFKCGAPEKSLDRNMSISASLVSDKRM 1489 >05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263, 2455287-2455436,2455526-2455681,2455775-2455986, 2456306-2456407,2456517-2456653,2456769-2457055 Length = 527 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/38 (31%), Positives = 25/38 (65%) Query: 126 DHFDDDKLFMNSLIPLFKKMSDDTRLLCRIEVLKIIRY 163 D DK+ + + +F+ +SD TR+L I++L+++R+ Sbjct: 37 DTHTGDKVAIKKINDIFEHVSDATRILREIKLLRLLRH 74 >05_05_0348 + 24271764-24271898,24273055-24273144,24273205-24273303, 24273725-24273826,24273912-24274088,24274193-24274398, 24274491-24274575,24274641-24274798,24274873-24274948, 24275117-24275245,24275313-24275457,24275561-24275691, 24276183-24276335,24276447-24276636,24277006-24277139, 24277248-24277406,24277659-24277964,24278040-24278216, 24278446-24278529,24278592-24278822,24278913-24279002, 24279090-24279211,24279293-24279448,24279477-24279635, 24279705-24279765,24280004-24280138,24280384-24280471, 24280548-24280620,24280883-24280994,24281691-24281711 Length = 1327 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Query: 246 KVSPVEVPRMSEMDESLIQVTSVAQMSTPLFMK-MYNLERSKAAPALSSTNQPMHVSVKT 304 + + V++ +++E + ++VTS + +K + L+ + A L+S + HV+ Sbjct: 278 RTASVQMLKLAEKERDNLEVTSAKNEAETFMLKELLLLKWQEKATTLASDDATSHVAQLQ 337 Query: 305 EPLEDAQSQLAS 316 E + D + LAS Sbjct: 338 ENVADLEKNLAS 349 >03_06_0448 - 34005581-34005655,34005735-34005830,34006669-34007616, 34007684-34007851,34007908-34008099,34008164-34008346, 34008414-34008590,34008667-34012074 Length = 1748 Score = 29.1 bits (62), Expect = 4.9 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 15/128 (11%) Query: 30 SVPQADVVSIEGATEQPRYSQ------DKYESFSEVSNSPQHAPPED---VIPKIKTEVI 80 ++P VVS G T + Q D+ +S +EVS S Q AP E + P+ + Sbjct: 1419 TLPTVQVVSTSGDTFSSKNEQNDVPWEDQNKSDAEVSESNQTAPKESERTIPPEHEDREE 1478 Query: 81 DKPLDLKTKAEVTDRPDTVDKCNQTVIDKNPSLEIKIDANSILPDDHFDDDKLFMNSLIP 140 +K +++ K E+ ++ + N V ++ S E I A S + DD +++K + + Sbjct: 1479 EKEENMENKIEI-----SIGRENDEVSEQETSTEECIVAPSGM-DDRDENNKGWAEESVQ 1532 Query: 141 LFKKMSDD 148 + + + D Sbjct: 1533 TYGRYASD 1540 >02_03_0026 - 14045653-14045874,14047023-14047215,14047518-14047618, 14050145-14050272,14050409-14050502,14050749-14051237, 14052622-14052915,14053602-14053732,14053829-14055440, 14055539-14055651,14055902-14056933,14057023-14057145, 14057250-14057688 Length = 1656 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 86 LKTKAEVTDRPDTVDKCNQTVIDKNP-SLEIKIDANSILPDDHFDDDKLFMNSLIP 140 + T+A ++ + D VDK N +ID+ P ++ +S+ D H ++NS+ P Sbjct: 1158 MSTRAILSTKNDYVDKLNANMIDRFPVQAKVYHSFDSVDDDPHNSYPLDYLNSITP 1213 >09_04_0500 - 18120287-18122233 Length = 648 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 245 LKVSPVEVPRMSEMDESLIQVTSVAQMSTPLFMKMYNLERSKAAPALSSTNQPMHVSVKT 304 LKV P E ++ D L S + +PL ++ + RS + P LS T + + Sbjct: 61 LKV-PTEESSLTFGDLVLNNDLSSIRNDSPLLLRKNQMHRSSSTPCLSPTAHDVQEQDHS 119 Query: 305 EPLE 308 EP+E Sbjct: 120 EPIE 123 >09_02_0163 - 5133805-5134252,5134353-5134460,5135693-5136012 Length = 291 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 43 TEQPRYSQ--DKYESFSEVSNSPQHAPPEDVIPKIKTEVIDKPL 84 T+ P+YS DKY S ++S H P D+ P+ V D L Sbjct: 202 TDSPKYSSINDKYASTRLTNHSDDHQPKNDMKPENLFAVPDMSL 245 >09_01_0044 + 796237-796327,797025-797079,798129-798639 Length = 218 Score = 28.3 bits (60), Expect = 8.5 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 4/89 (4%) Query: 133 LFMNSLIPLFKKMSDDTRLLCRIEVLKIIRYALQGHKCFEALKVAEDSFFRDRMS----G 188 LF+ +L+ L +S R+ + I + + G+ A VA + +S Sbjct: 11 LFLAALVILASLLSSCDADQVRVNSARGINWQVHGYSWSFAPIVAASTVAESTLSVEGAA 70 Query: 189 ILAKQEVDVATSKGAETRLSMTTRSADGS 217 ++ ++ + KG E R++ TT SAD + Sbjct: 71 VIESMHLEARSRKGGECRVTATTPSADAA 99 >05_07_0139 - 27968816-27968890,27969065-27969456,27969558-27969640, 27969841-27969933,27970012-27970223,27970604-27970753, 27971195-27971254,27971369-27971496,27972008-27972416, 27973514-27973570 Length = 552 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/38 (28%), Positives = 24/38 (63%) Query: 126 DHFDDDKLFMNSLIPLFKKMSDDTRLLCRIEVLKIIRY 163 D DK+ + + +F+ +SD R+L I++L+++R+ Sbjct: 55 DQHTGDKVAIKKIHNIFEHLSDAARILREIKLLRLLRH 92 >01_06_0168 + 27165323-27165373,27166659-27167067,27167666-27167793, 27167905-27167964,27169126-27169275,27169358-27169513, 27169643-27169854,27169983-27170084,27170351-27170430, 27170515-27170939 Length = 590 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/38 (28%), Positives = 24/38 (63%) Query: 126 DHFDDDKLFMNSLIPLFKKMSDDTRLLCRIEVLKIIRY 163 D DK+ + + +F+ +SD R+L I++L+++R+ Sbjct: 53 DQHTGDKVAIKKIHNIFEHLSDAARILREIKLLRLLRH 90 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.312 0.127 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,059,771 Number of Sequences: 37544 Number of extensions: 310824 Number of successful extensions: 739 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 734 Number of HSP's gapped (non-prelim): 18 length of query: 316 length of database: 14,793,348 effective HSP length: 82 effective length of query: 234 effective length of database: 11,714,740 effective search space: 2741249160 effective search space used: 2741249160 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -