BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000073-TA|BGIBMGA000073-PA|IPR004210|BESS motif (316 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 0.55 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 5.1 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.4 bits (53), Expect = 0.55 Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 235 EQLSRKQCPKLKVSPVEVPRMSEMDESLIQVTS 267 EQ SR++ P KV P +V E +E+ V S Sbjct: 413 EQKSRRKGPAFKVDPTQVESEEEDEETSTTVFS 445 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 22.2 bits (45), Expect = 5.1 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 73 PKIKTEVIDKPLDLKTKAEVTDRP--DTVDKCNQTVIDKNPSLEIKIDANSILPDD 126 P + V L +++ + RP DT +Q V D+N SLE ++ NS DD Sbjct: 60 PNLNPAVQGSSLTEGKRSKRSKRPNGDTNGDTSQ-VDDQNESLEASVNENSKNGDD 114 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.127 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,270 Number of Sequences: 317 Number of extensions: 2483 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 316 length of database: 114,650 effective HSP length: 57 effective length of query: 259 effective length of database: 96,581 effective search space: 25014479 effective search space used: 25014479 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -