SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000072-TA|BGIBMGA000072-PA|IPR000408|Regulator of
chromosome condensation, RCC1, IPR009091|Regulator of chromosome
condensation/beta-lactamase-inhibitor protein II
         (506 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8 ...    26   0.84 

>AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8
           protein.
          Length = 208

 Score = 25.8 bits (54), Expect = 0.84
 Identities = 11/37 (29%), Positives = 18/37 (48%)

Query: 169 GREGKPCKEPVKIDIGEPAVEIASGGDHLVVLTTSGG 205
           G + KP ++  K ++G PA     G   +  + T GG
Sbjct: 15  GGKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGG 51


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.312    0.132    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,595
Number of Sequences: 429
Number of extensions: 4343
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 506
length of database: 140,377
effective HSP length: 61
effective length of query: 445
effective length of database: 114,208
effective search space: 50822560
effective search space used: 50822560
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -