BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000072-TA|BGIBMGA000072-PA|IPR000408|Regulator of
chromosome condensation, RCC1, IPR009091|Regulator of chromosome
condensation/beta-lactamase-inhibitor protein II
(506 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 26 0.84
>AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8
protein.
Length = 208
Score = 25.8 bits (54), Expect = 0.84
Identities = 11/37 (29%), Positives = 18/37 (48%)
Query: 169 GREGKPCKEPVKIDIGEPAVEIASGGDHLVVLTTSGG 205
G + KP ++ K ++G PA G + + T GG
Sbjct: 15 GGKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGG 51
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.312 0.132 0.384
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,595
Number of Sequences: 429
Number of extensions: 4343
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 506
length of database: 140,377
effective HSP length: 61
effective length of query: 445
effective length of database: 114,208
effective search space: 50822560
effective search space used: 50822560
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -