BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000072-TA|BGIBMGA000072-PA|IPR000408|Regulator of chromosome condensation, RCC1, IPR009091|Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (506 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 26 0.84 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 25.8 bits (54), Expect = 0.84 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 169 GREGKPCKEPVKIDIGEPAVEIASGGDHLVVLTTSGG 205 G + KP ++ K ++G PA G + + T GG Sbjct: 15 GGKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGG 51 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.132 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,595 Number of Sequences: 429 Number of extensions: 4343 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 506 length of database: 140,377 effective HSP length: 61 effective length of query: 445 effective length of database: 114,208 effective search space: 50822560 effective search space used: 50822560 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -