BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000071-TA|BGIBMGA000071-PA|undefined (144 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0260 - 27233734-27234324,27234422-27234573,27235006-272351... 28 2.6 05_04_0389 - 20845490-20845600,20845697-20846006,20846097-208462... 27 7.9 02_05_0979 + 33268294-33269595 27 7.9 >02_05_0260 - 27233734-27234324,27234422-27234573,27235006-27235153, 27235547-27235956,27236137-27236212 Length = 458 Score = 28.3 bits (60), Expect = 2.6 Identities = 27/93 (29%), Positives = 36/93 (38%), Gaps = 11/93 (11%) Query: 6 NIILATQNRASSFKFNAS----FGQDSQFTVPITLVHGFCANVTLVPGQLARAELTVDIT 61 NI+L TQ A F + G S T + +G+ A P +A L V Sbjct: 257 NILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAA-----PEYVATGHLYVKSD 311 Query: 62 TVGIQITYEAYLSGVVALAYDRPHNGHHF--WA 92 G + L+G+ AL RP HH WA Sbjct: 312 VYGFGVVLLELLTGLRALDAGRPSGQHHLVDWA 344 >05_04_0389 - 20845490-20845600,20845697-20846006,20846097-20846242, 20846319-20846426,20846508-20846615,20846997-20847109, 20847340-20847437,20847530-20847714,20847811-20847953, 20848293-20848377,20848486-20848624,20848686-20848780, 20848894-20849037,20849114-20849206,20849310-20849376, 20849529-20849641,20849750-20849845,20853885-20854058 Length = 775 Score = 26.6 bits (56), Expect = 7.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 95 IDHVLYTCGTKNGITSEQYINISYYDNANL 124 + + +Y GT G + Y+ SYYD A L Sbjct: 303 VSYYMYHGGTNFGRFAASYVTTSYYDGAPL 332 >02_05_0979 + 33268294-33269595 Length = 433 Score = 26.6 bits (56), Expect = 7.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 85 HNGHHFWAPNIDHVLYTCGTKN 106 H+ H+ W P+ H+L GT N Sbjct: 137 HHTHYLWNPSTRHILRLPGTDN 158 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.136 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,889,114 Number of Sequences: 37544 Number of extensions: 138012 Number of successful extensions: 255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 253 Number of HSP's gapped (non-prelim): 3 length of query: 144 length of database: 14,793,348 effective HSP length: 75 effective length of query: 69 effective length of database: 11,977,548 effective search space: 826450812 effective search space used: 826450812 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -