BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000071-TA|BGIBMGA000071-PA|undefined (144 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061553-1|AAL29101.1| 595|Drosophila melanogaster LP08894p pro... 29 1.8 AE014297-1757|AAF54987.1| 595|Drosophila melanogaster CG9307-PA... 29 1.8 >AY061553-1|AAL29101.1| 595|Drosophila melanogaster LP08894p protein. Length = 595 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 83 RPHNGHHFWAPNIDHVLYTCGTKNGITSEQYINISYY 119 R + G WA ++D CG KNG+T Y N+ Y Sbjct: 366 RGYAGAMTWAIDMDDFHGMCGRKNGLTQILYDNMKNY 402 >AE014297-1757|AAF54987.1| 595|Drosophila melanogaster CG9307-PA protein. Length = 595 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 83 RPHNGHHFWAPNIDHVLYTCGTKNGITSEQYINISYY 119 R + G WA ++D CG KNG+T Y N+ Y Sbjct: 366 RGYAGAMTWAIDMDDFHGMCGRKNGLTQILYDNMKNY 402 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.322 0.136 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,736,005 Number of Sequences: 52641 Number of extensions: 252665 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 538 Number of HSP's gapped (non-prelim): 2 length of query: 144 length of database: 24,830,863 effective HSP length: 78 effective length of query: 66 effective length of database: 20,724,865 effective search space: 1367841090 effective search space used: 1367841090 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -